Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5848
Gene name
Locationscaffold_490:8385..9789
Strand-
Gene length (bp)1404
Transcript length (bp)1119
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 1.1E-48 27 224
PF07683 CobW_C Cobalamin synthesis protein cobW C-terminal domain 9.5E-06 305 368

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=1 SV=1 2 369 5.0E-91
sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 2 369 2.0E-90
sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 5 365 7.0E-88
sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 5 365 2.0E-87
sp|Q5JTY5|CBWD3_HUMAN COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=2 SV=1 5 365 4.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEH6|CBWD1_MOUSE COBW domain-containing protein 1 OS=Mus musculus GN=Cbwd1 PE=1 SV=1 2 369 5.0E-91
sp|Q99MB4|CBWD1_RAT COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2 2 369 2.0E-90
sp|Q8IUF1|CBWD2_HUMAN COBW domain-containing protein 2 OS=Homo sapiens GN=CBWD2 PE=1 SV=1 5 365 7.0E-88
sp|Q9BRT8|CBWD1_HUMAN COBW domain-containing protein 1 OS=Homo sapiens GN=CBWD1 PE=1 SV=1 5 365 2.0E-87
sp|Q5JTY5|CBWD3_HUMAN COBW domain-containing protein 3 OS=Homo sapiens GN=CBWD3 PE=2 SV=1 5 365 4.0E-85
sp|Q5RIA9|CBWD5_HUMAN COBW domain-containing protein 5 OS=Homo sapiens GN=CBWD5 PE=2 SV=1 5 365 2.0E-84
sp|Q4V339|CBWD6_HUMAN COBW domain-containing protein 6 OS=Homo sapiens GN=CBWD6 PE=3 SV=1 5 365 6.0E-84
sp|P53729|YN8H_YEAST Uncharacterized protein YNR029C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR029C PE=1 SV=1 25 369 4.0E-75
sp|O74310|YOG5_SCHPO COBW domain-containing protein C15D4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.05 PE=3 SV=1 19 356 1.0E-68
sp|P94400|YCIC_BACSU Putative metal chaperone YciC OS=Bacillus subtilis (strain 168) GN=yciC PE=2 SV=1 25 234 7.0E-32
sp|Q869Q0|Y4527_DICDI COBW domain-containing protein DDB_G0274527 OS=Dictyostelium discoideum GN=DDB_G0274527 PE=3 SV=1 25 252 4.0E-30
sp|P31521|P47K_PSECL 47 kDa protein OS=Pseudomonas chlororaphis PE=3 SV=1 25 246 5.0E-29
sp|Q9HZQ2|COBW_PSEAE Protein CobW OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobW PE=3 SV=1 25 211 7.0E-29
sp|P24203|YJIA_ECOLI Uncharacterized GTP-binding protein YjiA OS=Escherichia coli (strain K12) GN=yjiA PE=1 SV=3 26 365 2.0E-26
sp|A6NM15|CBWD7_HUMAN Putative COBW domain-containing protein 7 OS=Homo sapiens GN=CBWD7 PE=5 SV=3 133 365 2.0E-26
sp|P29937|COBW_PSEDE Protein CobW OS=Pseudomonas denitrificans GN=cobW PE=3 SV=3 25 217 2.0E-21
sp|P33030|YEIR_ECOLI Zinc-binding GTPase YeiR OS=Escherichia coli (strain K12) GN=yeiR PE=1 SV=2 29 261 4.0E-10
sp|P22042|YTR2_SPIAU Uncharacterized protein in trpE 3'region (Fragment) OS=Spirochaeta aurantia PE=4 SV=1 23 65 8.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7717 0.4162 0.0348 0.027 0.2429 0.0127 0.0714 0.1547 0.1781 0.03

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2481
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6055
Ophiocordyceps australis map64 (Brazil) OphauB2|2745
Ophiocordyceps camponoti-floridani Ophcf2|04023
Ophiocordyceps camponoti-rufipedis Ophun1|1971
Ophiocordyceps kimflemingae Ophio5|5848 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5848
MEFDEDAPPELVDTAGELHDELSVKVPITIVTGYLGAGKTTLLNYILTARHGKKIAVIMNEFGDSLDIEKSLTVN
KGEERFEEWLEVGNGCICCSVKDTGVNAIESLMSKKGAFDYILLETTGLADPGNIAPLFWVDDGLGSTIYLDGIV
TLVDARNILRSLEDASGKVDDHEHHGDKGSLMTTAHLQISHADVVVINKADLVDDDELRRVIERVESINGLARVH
VTERSVVPQLEGFLLDLHAYDDFKESEFRAKGHSHLDPAISTVCIPVPRLQTQQLHLVDAWLREVLWENRVPGSQ
DGGNFEIHRSKGRLVLESGEARMLQGVREVFELTEPPDGRESQPAEGKMIFIGRRLTEAGLADSFRRAIHGN
Coding >Ophio5|5848
ATGGAATTCGACGAGGATGCCCCTCCCGAGCTGGTGGACACTGCCGGGGAGCTGCATGACGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGGTTACCTTGGAGCCGGCAAGACGACCCTCTTGAACTATATCCTCACAGCACGA
CATGGGAAGAAGATTGCTGTCATCATGAATGAATTTGGCGACTCGCTGGACATTGAAAAGTCCCTCACTGTCAAC
AAGGGCGAGGAAAGGTTCGAGGAGTGGCTCGAGGTCGGAAACGGCTGCATTTGTTGCTCCGTCAAGGACACCGGA
GTCAACGCCATCGAATCTCTCATGAGCAAGAAGGGTGCCTTTGACTACATCCTGCTGGAGACAACTGGGCTTGCC
GATCCGGGAAACATTGCCCCTCTCTTCTGGGTGGATGATGGCCTGGGAAGCACGATATACCTAGACGGAATCGTC
ACCTTGGTCGACGCCAGGAACATCTTGCGCAGCCTCGAAGATGCGAGTGGCAAGGTGGACGACCATGAGCATCAC
GGCGACAAAGGTTCGCTGATGACGACGGCGCACCTGCAGATCTCACACGCAGATGTCGTCGTCATCAACAAGGCA
GATCTGGTTGACGACGATGAGCTGCGCCGGGTTATAGAACGAGTCGAGTCTATCAACGGGCTCGCAAGGGTGCAC
GTGACGGAGAGGAGCGTCGTCCCGCAACTGGAAGGCTTCCTACTGGACTTACACGCGTACGATGACTTCAAGGAG
AGCGAGTTCAGGGCCAAGGGACACAGCCATCTGGACCCGGCAATCTCGACAGTCTGCATTCCGGTTCCTCGGTTG
CAGACACAGCAATTGCATCTTGTCGATGCGTGGCTGCGGGAGGTGCTTTGGGAGAACAGAGTGCCGGGCTCGCAG
GACGGGGGGAACTTTGAGATTCATCGCTCCAAGGGTCGCCTCGTCCTAGAAAGCGGGGAGGCAAGGATGCTTCAG
GGGGTCAGAGAGGTGTTTGAACTGACAGAGCCACCAGACGGTCGGGAGTCACAGCCGGCCGAGGGCAAGATGATT
TTCATCGGAAGGCGGCTGACAGAAGCGGGCCTGGCGGACAGTTTCAGGAGGGCCATCCATGGCAAT
Transcript >Ophio5|5848
ATGGAATTCGACGAGGATGCCCCTCCCGAGCTGGTGGACACTGCCGGGGAGCTGCATGACGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGGTTACCTTGGAGCCGGCAAGACGACCCTCTTGAACTATATCCTCACAGCACGA
CATGGGAAGAAGATTGCTGTCATCATGAATGAATTTGGCGACTCGCTGGACATTGAAAAGTCCCTCACTGTCAAC
AAGGGCGAGGAAAGGTTCGAGGAGTGGCTCGAGGTCGGAAACGGCTGCATTTGTTGCTCCGTCAAGGACACCGGA
GTCAACGCCATCGAATCTCTCATGAGCAAGAAGGGTGCCTTTGACTACATCCTGCTGGAGACAACTGGGCTTGCC
GATCCGGGAAACATTGCCCCTCTCTTCTGGGTGGATGATGGCCTGGGAAGCACGATATACCTAGACGGAATCGTC
ACCTTGGTCGACGCCAGGAACATCTTGCGCAGCCTCGAAGATGCGAGTGGCAAGGTGGACGACCATGAGCATCAC
GGCGACAAAGGTTCGCTGATGACGACGGCGCACCTGCAGATCTCACACGCAGATGTCGTCGTCATCAACAAGGCA
GATCTGGTTGACGACGATGAGCTGCGCCGGGTTATAGAACGAGTCGAGTCTATCAACGGGCTCGCAAGGGTGCAC
GTGACGGAGAGGAGCGTCGTCCCGCAACTGGAAGGCTTCCTACTGGACTTACACGCGTACGATGACTTCAAGGAG
AGCGAGTTCAGGGCCAAGGGACACAGCCATCTGGACCCGGCAATCTCGACAGTCTGCATTCCGGTTCCTCGGTTG
CAGACACAGCAATTGCATCTTGTCGATGCGTGGCTGCGGGAGGTGCTTTGGGAGAACAGAGTGCCGGGCTCGCAG
GACGGGGGGAACTTTGAGATTCATCGCTCCAAGGGTCGCCTCGTCCTAGAAAGCGGGGAGGCAAGGATGCTTCAG
GGGGTCAGAGAGGTGTTTGAACTGACAGAGCCACCAGACGGTCGGGAGTCACAGCCGGCCGAGGGCAAGATGATT
TTCATCGGAAGGCGGCTGACAGAAGCGGGCCTGGCGGACAGTTTCAGGAGGGCCATCCATGGCAATTGA
Gene >Ophio5|5848
ATGGAATTCGACGAGGATGCCCCTCCCGAGCTGGTGGACACTGCCGGGGAGCTGCATGACGAGCTGTCGGTCAAA
GTGCCAATTACCATTGTGACCGGTGCGTCGACGAGCTCCGAGATGGCGAGGGCAAGCGATAGCATAAGAGGACTC
ATCTCAAAGTATTGGCTCAGGTTACCTTGGAGCCGGCAAGACGACCCTCTTGAACTATATCCTCACAGCACGACA
TGGGAAGAAGATTGCTGTCATCATGAATGGTTGTGAGACCGCCAGTTCGAACTACTTATGCCCTTACTGACATGG
AGCAGAATTTGGCGACTGTGAGTGACTACGACTCTATGTGCAGACGAGACGTCTAAAATGTGTCGCAGCGCTGGA
CATTGAAAAGTCCCTCACTGTCAACAAGGGCGAGGAAAGGTTCGAGGAGTGGCTCGAGGTCGGAAACGGCTGCAT
TTGTTGCTCCGTCAAGTTGGTTTGACCACGGACGTTGAGATCTGCGCCCGCTGACGGCCGCTCAGGGACACCGGA
GTCAACGCCATCGAATCTCTCATGAGCAAGAAGGGTGCCTTTGACTACATCCTGCTGGAGACAACTGGGCTTGCC
GATCCGGGAAACATTGCCCCTCTCTTCTGGGTGGATGATGGCCTGGGAAGCACGATATACCTAGACGGAATCGTC
ACCTTGGTCGACGCCAGGAACATCTTGCGCAGCCTCGAAGATGCGAGTGGCAAGGTGGACGACCATGAGCATCAC
GGCGACAAAGGTTCGCTGATGACGACGGCGCACCTGCAGATCTCACACGCAGATGTCGTCGTCATCAACAAGGCA
GATCTGGTTGACGACGATGAGCTGCGCCGGGTTATAGAACGAGTCGAGTCTATCAACGGGCTCGCAAGGGTGCAC
GTGACGGAGAGGAGCGTCGTCCCGCAACTGGAAGGCTTCCTACTGGACTTACACGCGTACGATGACTTCAAGGAG
AGCGAGTTCAGGGCCAAGGGACACAGCCATCTGGACCCGGTGAGTGACGAGAGGCGGCGCCCGATATAACGGCTG
GACCAGTGGGACTGACGGCTGCAGGCAATCTCGACAGTCTGCATTCCGGTTCCTCGGTTGCAGACACAGCAATTG
CATCTTGTCGATGCGTGGCTGCGGGAGGTGCTTTGGGAGAACAGAGTGCCGGGCTCGCAGGACGGGGGGAACTTT
GAGATTCATCGCTCCAAGGGTCGCCTCGTCCTAGAAAGCGGGGAGGCAAGGATGCTTCAGGGGGTCAGAGAGGTG
TTTGAACTGACAGAGCCACCAGACGGTCGGGAGTCACAGCCGGCCGAGGGCAAGATGATTTTCATCGGAAGGCGG
CTGACAGAAGCGGGCCTGGCGGACAGTTTCAGGAGGGCCATCCATGGCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail