Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5847
Gene name
Locationscaffold_490:5521..7946
Strand-
Gene length (bp)2425
Transcript length (bp)1401
Coding sequence length (bp)1398
Protein length (aa) 466

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family 1.7E-29 342 453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87240|NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not2 PE=1 SV=2 305 454 7.0E-31
sp|Q9NZN8|CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens GN=CNOT2 PE=1 SV=1 287 454 3.0E-25
sp|Q8C5L3|CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus GN=Cnot2 PE=1 SV=2 287 454 4.0E-25
sp|Q52JK6|VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana GN=VIP2 PE=1 SV=1 277 454 3.0E-23
sp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana GN=VIP2 PE=1 SV=2 263 450 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87240|NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not2 PE=1 SV=2 305 454 7.0E-31
sp|Q9NZN8|CNOT2_HUMAN CCR4-NOT transcription complex subunit 2 OS=Homo sapiens GN=CNOT2 PE=1 SV=1 287 454 3.0E-25
sp|Q8C5L3|CNOT2_MOUSE CCR4-NOT transcription complex subunit 2 OS=Mus musculus GN=Cnot2 PE=1 SV=2 287 454 4.0E-25
sp|Q52JK6|VIP2_NICBE Probable NOT transcription complex subunit VIP2 (Fragment) OS=Nicotiana benthamiana GN=VIP2 PE=1 SV=1 277 454 3.0E-23
sp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP2 OS=Arabidopsis thaliana GN=VIP2 PE=1 SV=2 263 450 4.0E-22
sp|Q94547|RGA_DROME Regulator of gene activity OS=Drosophila melanogaster GN=Rga PE=1 SV=2 289 454 4.0E-19
sp|P06100|NOT2_YEAST General negative regulator of transcription subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC36 PE=1 SV=1 353 450 2.0E-18
sp|Q8K0V4|CNOT3_MOUSE CCR4-NOT transcription complex subunit 3 OS=Mus musculus GN=Cnot3 PE=1 SV=1 369 454 2.0E-09
sp|O75175|CNOT3_HUMAN CCR4-NOT transcription complex subunit 3 OS=Homo sapiens GN=CNOT3 PE=1 SV=1 369 454 2.0E-09
sp|O13870|NOT3_SCHPO General negative regulator of transcription subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=not3 PE=1 SV=2 374 454 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6962 0.6632 0.0607 0.0251 0.0535 0.0048 0.1262 0.0334 0.0302 0.0838

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6056
Ophiocordyceps australis map64 (Brazil) OphauB2|2744
Ophiocordyceps camponoti-floridani Ophcf2|04024
Ophiocordyceps camponoti-rufipedis Ophun1|1970
Ophiocordyceps kimflemingae Ophio5|5847 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5847
MMNRPVPQTLRGMPGNFGGQPQPQQQGRPVSNRLPNGKIANNASSWGFGGGLPMGAAGFPNQGHQLGGNLSFAQS
LTGSQPATPLDLSEFPSLANNSQLNAAGQASMWSAAGSRNPNGPVQRNQSIPVTTQPSGQDDLFNPAPSRVPPNQ
AANGYLRSERGANMMSSLGFAPQNTSSANVQANKGNGLLNALSANSRANEARSPPGGGASTSSRAPDAKRPDDMR
QKPPTFRDDGFGKGSTGDGTMPATGARSQLGVIGNEGSLGKFKDDKASQHPEAVDPLAGMAAVDKWGIKGLRTLM
NNYPDFHAMVVGMDPSTLGLDLSTQELISPQIYSLFDEQPPRPTVTSSKFRLPDCYSVTNVQPIESKIQSFNEET
LFWLFYSCPADIKQQMAAVELHSRNWRWHKKLQIWLTKDEHMNPQILSPNHERGYYIVWDANNWRKDRREFTLHY
GDLDTTLSGGPTLSMS
Coding >Ophio5|5847
ATGATGAATCGGCCAGTGCCGCAAACGCTACGAGGCATGCCTGGCAACTTCGGAGGCCAACCACAGCCCCAGCAA
CAAGGGCGACCAGTATCAAACCGGCTGCCCAACGGGAAAATCGCCAACAATGCATCGAGTTGGGGGTTTGGCGGC
GGCCTTCCCATGGGAGCTGCCGGTTTTCCAAATCAAGGGCACCAGCTAGGGGGAAACCTCAGTTTTGCTCAAAGC
TTGACAGGGTCGCAACCTGCCACGCCATTGGATCTATCAGAGTTTCCTTCCCTGGCCAACAACTCGCAACTGAAC
GCTGCCGGGCAGGCCTCGATGTGGTCAGCTGCCGGCTCGCGAAATCCCAACGGCCCTGTCCAGCGCAACCAGTCC
ATACCGGTTACCACCCAGCCGTCAGGACAAGACGACCTGTTTAACCCCGCACCTTCTCGGGTGCCGCCCAACCAA
GCTGCCAACGGTTATCTCCGATCGGAGCGAGGTGCCAACATGATGTCGTCGCTAGGGTTTGCGCCTCAAAACACC
AGCTCGGCGAACGTACAGGCGAACAAAGGCAACGGCTTACTGAATGCCCTGTCTGCAAACAGTCGGGCCAATGAG
GCGCGGTCGCCACCTGGAGGAGGTGCATCCACCTCGTCACGAGCGCCGGACGCAAAGCGACCCGACGACATGAGG
CAGAAGCCGCCCACATTCCGCGACGATGGCTTCGGGAAGGGCTCTACAGGCGACGGGACGATGCCGGCAACCGGT
GCACGGAGCCAACTTGGCGTCATCGGGAATGAGGGTTCGTTGGGGAAGTTCAAGGACGACAAGGCGAGCCAACAT
CCTGAAGCCGTCGACCCTCTTGCCGGAATGGCGGCCGTGGACAAATGGGGCATCAAAGGCCTGCGAACTCTGATG
AACAATTACCCCGACTTTCATGCCATGGTGGTGGGTATGGATCCGAGCACGCTCGGGCTGGACTTGAGCACGCAA
GAGCTTATTTCTCCGCAAATCTACTCCCTCTTCGACGAGCAGCCGCCAAGGCCGACAGTAACTTCGAGCAAGTTC
CGGCTGCCTGACTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAATGAGGAGACG
TTATTCTGGCTCTTCTACAGCTGTCCGGCAGACATTAAGCAACAAATGGCGGCGGTGGAGCTGCATTCTCGGAAC
TGGCGGTGGCATAAAAAGCTCCAGATCTGGCTCACCAAAGATGAGCACATGAACCCGCAAATTCTTAGCCCCAAC
CACGAGCGAGGCTACTACATCGTGTGGGACGCCAACAACTGGCGGAAAGACCGAAGAGAGTTTACGCTGCACTAC
GGTGACCTGGACACGACGTTGAGCGGAGGACCGACATTAAGTATGTCG
Transcript >Ophio5|5847
ATGATGAATCGGCCAGTGCCGCAAACGCTACGAGGCATGCCTGGCAACTTCGGAGGCCAACCACAGCCCCAGCAA
CAAGGGCGACCAGTATCAAACCGGCTGCCCAACGGGAAAATCGCCAACAATGCATCGAGTTGGGGGTTTGGCGGC
GGCCTTCCCATGGGAGCTGCCGGTTTTCCAAATCAAGGGCACCAGCTAGGGGGAAACCTCAGTTTTGCTCAAAGC
TTGACAGGGTCGCAACCTGCCACGCCATTGGATCTATCAGAGTTTCCTTCCCTGGCCAACAACTCGCAACTGAAC
GCTGCCGGGCAGGCCTCGATGTGGTCAGCTGCCGGCTCGCGAAATCCCAACGGCCCTGTCCAGCGCAACCAGTCC
ATACCGGTTACCACCCAGCCGTCAGGACAAGACGACCTGTTTAACCCCGCACCTTCTCGGGTGCCGCCCAACCAA
GCTGCCAACGGTTATCTCCGATCGGAGCGAGGTGCCAACATGATGTCGTCGCTAGGGTTTGCGCCTCAAAACACC
AGCTCGGCGAACGTACAGGCGAACAAAGGCAACGGCTTACTGAATGCCCTGTCTGCAAACAGTCGGGCCAATGAG
GCGCGGTCGCCACCTGGAGGAGGTGCATCCACCTCGTCACGAGCGCCGGACGCAAAGCGACCCGACGACATGAGG
CAGAAGCCGCCCACATTCCGCGACGATGGCTTCGGGAAGGGCTCTACAGGCGACGGGACGATGCCGGCAACCGGT
GCACGGAGCCAACTTGGCGTCATCGGGAATGAGGGTTCGTTGGGGAAGTTCAAGGACGACAAGGCGAGCCAACAT
CCTGAAGCCGTCGACCCTCTTGCCGGAATGGCGGCCGTGGACAAATGGGGCATCAAAGGCCTGCGAACTCTGATG
AACAATTACCCCGACTTTCATGCCATGGTGGTGGGTATGGATCCGAGCACGCTCGGGCTGGACTTGAGCACGCAA
GAGCTTATTTCTCCGCAAATCTACTCCCTCTTCGACGAGCAGCCGCCAAGGCCGACAGTAACTTCGAGCAAGTTC
CGGCTGCCTGACTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAATGAGGAGACG
TTATTCTGGCTCTTCTACAGCTGTCCGGCAGACATTAAGCAACAAATGGCGGCGGTGGAGCTGCATTCTCGGAAC
TGGCGGTGGCATAAAAAGCTCCAGATCTGGCTCACCAAAGATGAGCACATGAACCCGCAAATTCTTAGCCCCAAC
CACGAGCGAGGCTACTACATCGTGTGGGACGCCAACAACTGGCGGAAAGACCGAAGAGAGTTTACGCTGCACTAC
GGTGACCTGGACACGACGTTGAGCGGAGGACCGACATTAAGTATGTCGTAG
Gene >Ophio5|5847
ATGATGAATCGGCCAGGTAGGACAAGCCCTGAAAACCCCCCCCCCCTCGTCCCTATCCTCCCCTCCCCCTTTGAA
TCCCTTGGCCAGCCCTCAGCCTCGGGCACCCCCGCGCCCACGACGATAACTCGAACGATCGACGACGATGCCGAC
ACTGAACGAGCTGCATCGCCGCCGACGTGCCACTGGACGGCGGATATGAAGCTGTGGCCGGTACCGATGCGAGCG
CGGCGATTGACTACGGTCTCGACACGATGCCCATTACCTCGAAAACTCCGAATGTCGGGCGCAAATAGGCCAGGA
CTATCTTGCCTAGTCTATTTCTGGCTTCATATCTCGCTTTCTGCACCGTAAAGACCTGCGTCCATCATGTGCCTG
ATACTGACGACATGCCGTGAACAGTGCCGCAAACGCTACGAGGCATGCCTGGCAACTTCGGAGGCCAACCACAGC
CCCAGCAACAAGGGCGACCAGTATCAAACCGGCTGCCCAACGGGAAAATCGGTTCGAACTACCCGACTAACCTTG
GAGCCGCTGCCTGTGGCTGACGAGTATAATGAGCCAGCCAACAATGCATCGAGTTGGGGGTTTGGCGGCGGCCTT
CCCATGGGAGCTGCCGGTTTTCCAAATCAAGGGCACCAGCTAGGGGGAAACCTCAGTTTTGCTCAAAGCTTGACA
GGGTCGCAACCTGCCACGCCATTGGATCTATCGTACGTATCCGCTTGCTCTCCCCTACCTCGTTGCCGCTCTCCC
CTACACGCTTCTGTGAATCGCGCCGTCGCGGCCAGCCTTGGCAACAAAAAAAGACGATTGCAGTTGGCCGTGTTT
CCACAGAGAAACCCGACGCAATCAACCTATTGGCCTTTCTGTCGAAGGGCTCGCACACGGCTTCTGCTTCTGCTT
CCACCTCCTGACTCAATCTACTGCCTTGTTGACCTGCCCTCCGTGCCGCAGGACCTGTATCAGACAACGCTGACA
AGGAAATACGCTAACTGCCTTTAGAGAGTTTCCTTCCCTGGCCAACAACTCGCAACTGAACGCTGCCGGGCAGGC
CTCGATGTGGTCAGCTGCCGGCTCGCGAAATCCCAACGGCCCTGTCCAGCGCAACCAGTCCATACCGGTTACCAC
CCAGCCGTCAGGACAAGACGACCTGTTTAACCCCGCACCTTCTCGGGTGCCGCCCAACCAAGGTTCGTTTCTCGG
CACCAAACTCCGCCGTCTCTCAGGGCCAAAACGGGCAGCGTTGACACTCGGAGCAAAGCTGCCAACGGTTATCTC
CGATCGGAGCGAGGTGCCAACATGATGTCGTCGCTAGGGTTTGCGCCTCAAAACACCAGCTCGGCGAACGTACAG
GCGAACAAAGGCAACGGCTTACTGAATGCCCTGTCTGCAAACAGTCGGGCCAATGAGGCGCGGTCGCCACCTGGA
GGAGGTGCATCCAGTAGGCCTACCCCTCTTTGATGGTGTGTTTCACCGCGTGTTGACTTGGGCCAGCCTCGTCAC
GAGCGCCGGACGCAAAGCGACCCGACGACATGAGGCAGAAGCCGCCCACATTCCGCGACGATGGCTTCGGGAAGG
GCTCTACAGGCGACGGGACGATGCCGGCAACCGGTGCACGGAGCCAACTTGGCGTCATCGGGAATGAGGGTTCGT
TGGGGAAGTTCAAGGACGACAAGGCGAGCCAACATCCTGAAGCCGTCGACCCTCTTGCCGGAATGGCGGCCGTGG
ACAAATGGGGCATCAAAGGCCTGCGAACTCTGATGAACAATTACCCCGACTTTCATGCCATGGTGGTGGGTATGG
ATCCGAGCACGCTCGGGCTGGACTTGAGCACGCAAGAGTGAGTCTCTCTAGCAGAACGGTTTCCGACACTGGCTG
ACGGGAGCAAGGCTTATTTCTCCGCAAATCTACTCCCTCTTCGACGAGCAGCCGCCAAGGCCGACAGTAACTTCG
AGCAAGTTCCGGCTGCCTGACTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAAT
GAGGAGACGTTATTCTGGCTCTTCTACAGCTGTCCGGCAGACATTAAGCAACAAATGGCGGCGGTGGAGCTGTAA
GAGCCCCCCCCCCCCCAACTTCGCATGCCTCGAAGCCGCCTCTGACGGTTTGACAGGCATTCTCGGAACTGGCGG
TGGCATAAAAAGCTCCAGATCTGGCTCACCAAAGATGAGCACATGAACCCGCAAATTCTTAGCCCCAACCACGAG
CGAGGCTACTACATCGTGTGGGACGCCAACAACTGGCGGAAAGACCGAGTAGGTGAAGCATGCCCGGTCGTGGCT
GGACAAGTTGCTGACGGAAGGTCCTCAGAGAGAGTTTACGCTGCACTACGGTGACCTGGACACGACGTTGAGCGG
AGGACCGACATTAAGTATGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail