Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5846
Gene name
Locationscaffold_490:4267..4898
Strand-
Gene length (bp)631
Transcript length (bp)570
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02845 CUE CUE domain 5.7E-10 47 87

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6BKU8|CUE1_DEBHA Coupling of ubiquitin conjugation to ER degradation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CUE1 PE=3 SV=1 51 183 5.0E-11
sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 48 189 2.0E-06
sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 48 186 2.0E-06
sp|P87238|CUE4_SCHPO CUE domain-containing protein 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.13c PE=3 SV=1 51 184 3.0E-06

GO

GO Term Description Terminal node
GO:0043130 ubiquitin binding Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0032182 ubiquitin-like protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5846
MANDQISLPYLAAILLVSGLMIRYLFFSGPPVRRLATTSPEAAMRSREAAVERIQQMFPQTERRSILWDLQRNGG
SIQSTTERILAGRLETPPVSFQPPPAPVQATTSSSAESATRPSEKAAQPDLITRYNLKGKLDVPIEEDSKALKGW
SSSRDERQLMLQRRRDEMILAARRKMEAKMAAEKTACRS
Coding >Ophio5|5846
ATGGCCAACGATCAGATATCGCTGCCGTACTTGGCGGCCATCCTACTGGTATCGGGGTTGATGATCCGCTATCTC
TTCTTCTCGGGGCCGCCGGTGCGAAGGCTCGCGACGACATCGCCCGAGGCGGCAATGCGATCGCGAGAGGCGGCA
GTGGAGAGAATCCAGCAGATGTTCCCTCAGACGGAGCGGAGAAGCATCCTTTGGGACCTGCAGCGGAACGGCGGG
AGCATCCAGAGCACGACGGAACGGATCCTCGCTGGTCGTCTGGAGACGCCACCCGTCTCGTTTCAGCCGCCGCCA
GCGCCGGTCCAAGCGACAACCAGTTCAAGTGCCGAGTCGGCAACGCGGCCGTCTGAGAAGGCGGCTCAGCCGGAT
CTGATTACGCGCTACAATCTCAAGGGGAAGCTCGACGTGCCGATCGAGGAGGATAGCAAGGCGTTGAAGGGCTGG
AGCTCGAGTAGAGATGAGCGTCAGTTGATGCTGCAGCGAAGGAGGGACGAGATGATCCTGGCAGCGCGGCGCAAG
ATGGAGGCCAAGATGGCGGCGGAAAAGACGGCGTGTAGGAGC
Transcript >Ophio5|5846
ATGGCCAACGATCAGATATCGCTGCCGTACTTGGCGGCCATCCTACTGGTATCGGGGTTGATGATCCGCTATCTC
TTCTTCTCGGGGCCGCCGGTGCGAAGGCTCGCGACGACATCGCCCGAGGCGGCAATGCGATCGCGAGAGGCGGCA
GTGGAGAGAATCCAGCAGATGTTCCCTCAGACGGAGCGGAGAAGCATCCTTTGGGACCTGCAGCGGAACGGCGGG
AGCATCCAGAGCACGACGGAACGGATCCTCGCTGGTCGTCTGGAGACGCCACCCGTCTCGTTTCAGCCGCCGCCA
GCGCCGGTCCAAGCGACAACCAGTTCAAGTGCCGAGTCGGCAACGCGGCCGTCTGAGAAGGCGGCTCAGCCGGAT
CTGATTACGCGCTACAATCTCAAGGGGAAGCTCGACGTGCCGATCGAGGAGGATAGCAAGGCGTTGAAGGGCTGG
AGCTCGAGTAGAGATGAGCGTCAGTTGATGCTGCAGCGAAGGAGGGACGAGATGATCCTGGCAGCGCGGCGCAAG
ATGGAGGCCAAGATGGCGGCGGAAAAGACGGCGTGTAGGAGCTGA
Gene >Ophio5|5846
ATGGCCAACGATCAGATATCGCTGCCGTACTTGGCGGCCATCCTACTGGTATCGGGGTTGATGATCCGCTATCTC
TTCTTCTCGGGGCCGCCGGTGCGAAGGCTCGCGACGACATCGCCCGAGGCGGCAATGCGATCGCGAGAGGCGGCA
GTGGAGAGAATCCAGCAGATGTTCCCTCAGACGGAGCGGAGAAGCATCCTTTGGGACCTGCAGCGGAACGGCGGG
AGCATCCAGAGCACGACGGAACGGATCCTCGCTGGTCGTCTGGAGACGGTGAGAGGCCTGCTTCCAACTCCTTGT
GGATGGAAATGACTAACGATCGGAGAACGACTAGCCACCCGTCTCGTTTCAGCCGCCGCCAGCGCCGGTCCAAGC
GACAACCAGTTCAAGTGCCGAGTCGGCAACGCGGCCGTCTGAGAAGGCGGCTCAGCCGGATCTGATTACGCGCTA
CAATCTCAAGGGGAAGCTCGACGTGCCGATCGAGGAGGATAGCAAGGCGTTGAAGGGCTGGAGCTCGAGTAGAGA
TGAGCGTCAGTTGATGCTGCAGCGAAGGAGGGACGAGATGATCCTGGCAGCGCGGCGCAAGATGGAGGCCAAGAT
GGCGGCGGAAAAGACGGCGTGTAGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail