Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5843
Gene name
Locationscaffold_49:54624..56752
Strand+
Gene length (bp)2128
Transcript length (bp)1875
Coding sequence length (bp)1872
Protein length (aa) 624

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04922 DIE2_ALG10 DIE2/ALG10 family 1.9E-123 12 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 14 624 0.0E+00
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 14 624 3.0E-151
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 14 444 9.0E-125
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 14 624 3.0E-91
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 13 624 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 14 624 0.0E+00
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 14 624 3.0E-151
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 14 444 9.0E-125
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 14 624 3.0E-91
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 13 624 2.0E-87
sp|Q6CEA5|ALG10_YARLI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG10 PE=3 SV=1 14 624 2.0E-46
sp|Q75AQ8|ALG10_ASHGO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG10 PE=3 SV=2 14 624 1.0E-36
sp|Q6CN27|ALG10_KLULA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG10 PE=3 SV=1 14 610 5.0E-36
sp|Q5BKT4|AG10A_HUMAN Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10 PE=2 SV=1 14 434 2.0E-33
sp|Q10254|ALG10_SCHPO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg10 PE=3 SV=1 14 431 4.0E-33
sp|Q6FL34|ALG10_CANGA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG10 PE=3 SV=1 7 624 1.0E-32
sp|P50076|ALG10_YEAST Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIE2 PE=1 SV=2 8 624 1.0E-32
sp|Q5I7T1|AG10B_HUMAN Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10B PE=1 SV=2 14 434 6.0E-31
sp|O88788|AG10B_RAT Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Rattus norvegicus GN=Alg10b PE=1 SV=1 14 434 5.0E-29
sp|Q3UGP8|AG10B_MOUSE Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Mus musculus GN=Alg10b PE=2 SV=1 14 434 1.0E-28
sp|Q8T8L8|ALG10_DROME Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Drosophila melanogaster GN=Alg10 PE=2 SV=1 14 299 8.0E-27
sp|Q59YV2|ALG10_CANAL Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG10 PE=3 SV=1 13 606 4.0E-25
sp|Q6BW42|ALG10_DEBHA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG10 PE=3 SV=1 14 419 3.0E-23
sp|Q4P2W6|ALG10_USTMA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ALG10 PE=3 SV=1 100 414 2.0E-15
sp|Q4P2W6|ALG10_USTMA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ALG10 PE=3 SV=1 514 624 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0106073 dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity Yes
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0046527 glucosyltransferase activity No
GO:0044238 primary metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0016758 hexosyltransferase activity No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006629 lipid metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.069 0.2628 0.0103 0.1433 0.2 0.0305 0.738 0.1508 0.5089 0.0225

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 70 87 17
2 107 129 22
3 160 182 22
4 260 282 22
5 297 319 22
6 374 396 22
7 411 433 22
8 585 607 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT59 7.5E-128 13 545

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5667
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2937
Ophiocordyceps australis map64 (Brazil) OphauB2|4623
Ophiocordyceps camponoti-floridani Ophcf2|02892
Ophiocordyceps camponoti-rufipedis Ophun1|1804
Ophiocordyceps kimflemingae Ophio5|5843 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8194

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5843
MDLLPWAVAASACDEVFHIPQAQRYCHGRFGEWDDKITTPPGLYLLSNLLPQAFNVTGLSWTHSCEPNSLRAFNL
VGLAVLAYLFLLCRRRIEERLSPTQQQPPTRFAIHSACNVALFPLLFFFSGLYYTDVASTAVVLAAFLNHLNRVA
RDRSSTKSDLFTVALGLLALLMRQTNVFWAVVYMGGMEVVHAITTMKSESKHPPVMNGRIDQLLFMIREYSIGRV
HDPPLCKAKMDDTLLTAFSFGIAALCNPIRVLRQIWPYMTVLGAFVVFVVWNGAVVLGDKSNHVATIHFAQLLYM
WPLFVFFSWPLLLPQALGLDAGLRTFLTSVLNARWATARKENDTRKHALSDATPKRRRSQIQKTSQKAERLRNLL
WIICFLGAILLCCAIVRFNTIIHPFTLADNRHYMFYVFRYSIGRASWIRYTLVGPYLLSCNMIMSAMAGYSKGCQ
EASRASHSQLPPAPPRTNFIHDAESEDSEVDEDAEEAGKMRHPGKPLRPNPLRHLPSLPYTSTGLIWLLATSLSL
VTAPLVEPRYFIAPWVLWRLLVPEWRLCGNQDGAEDGPKSRHDEAHELFRWHDMRLVVETAWFAVINLATCYVFI
AKPFIWRDEAGGVLDNGRLQRFMW
Coding >Ophio5|5843
ATGGACCTCTTGCCATGGGCTGTAGCCGCCAGCGCGTGTGACGAGGTGTTTCATATACCCCAGGCTCAAAGATAT
TGTCATGGAAGATTCGGCGAGTGGGACGATAAGATTACGACGCCTCCTGGCCTCTATCTACTGTCCAATCTGCTC
CCACAGGCTTTCAACGTGACAGGACTGAGCTGGACTCACAGCTGCGAACCAAATAGTCTTCGTGCCTTCAATCTC
GTCGGCTTGGCCGTACTAGCCTACTTATTCCTGCTCTGCCGGCGCCGGATCGAAGAGCGCCTCTCGCCAACACAG
CAGCAGCCTCCGACGAGATTCGCCATTCACTCGGCCTGCAATGTCGCCCTGTTTCCCTTGTTGTTCTTCTTCTCC
GGACTGTACTACACGGACGTCGCCTCTACCGCCGTTGTACTTGCTGCCTTTCTCAACCACCTCAATCGCGTGGCT
CGCGACCGCAGCTCTACGAAGAGTGATCTTTTCACCGTCGCGCTGGGGCTTTTAGCCCTTCTCATGCGTCAGACC
AACGTATTCTGGGCCGTCGTGTACATGGGCGGCATGGAAGTCGTGCACGCCATCACGACTATGAAATCAGAGTCG
AAGCATCCGCCTGTCATGAATGGCCGAATCGACCAACTCCTGTTTATGATTCGAGAGTACTCCATTGGTCGCGTC
CACGACCCGCCTCTATGTAAGGCTAAAATGGATGATACACTCCTCACGGCCTTCAGCTTCGGAATTGCCGCCTTA
TGCAATCCCATTCGGGTATTGAGGCAGATCTGGCCATACATGACGGTTCTTGGAGCCTTTGTTGTCTTTGTCGTC
TGGAACGGAGCCGTTGTTCTCGGGGACAAGTCGAACCATGTGGCCACCATCCACTTTGCTCAGTTACTCTATATG
TGGCCCTTGTTTGTCTTCTTTTCGTGGCCCTTGCTGCTGCCGCAAGCTCTCGGCCTTGATGCGGGCCTGAGAACA
TTCTTGACGTCGGTTTTGAATGCACGGTGGGCTACAGCCAGGAAAGAAAACGACACCAGGAAGCACGCGCTATCT
GATGCTACGCCCAAACGACGGCGATCTCAAATACAAAAAACTTCACAGAAGGCTGAGCGTCTGAGGAACCTCCTC
TGGATAATCTGCTTTCTGGGAGCCATCCTGCTTTGTTGCGCCATAGTGCGATTCAACACCATCATTCACCCGTTC
ACGTTGGCCGACAACCGACACTATATGTTCTACGTCTTTCGATATTCGATCGGTCGCGCATCATGGATTAGGTAC
ACGCTAGTCGGACCGTACTTGCTGAGCTGTAATATGATCATGAGTGCCATGGCAGGATACAGCAAAGGGTGCCAG
GAGGCGAGCCGTGCGTCTCATAGCCAACTGCCACCTGCTCCCCCAAGGACCAACTTCATCCATGACGCGGAGTCA
GAAGATTCCGAAGTCGACGAAGACGCCGAGGAGGCTGGGAAGATGCGGCACCCAGGCAAGCCCTTGCGACCCAAC
CCGCTTCGTCACTTGCCGTCTCTGCCATACACCTCCACCGGCCTCATCTGGCTGTTGGCTACAAGTCTCTCCCTG
GTGACGGCGCCGTTGGTCGAGCCGCGGTACTTTATCGCGCCTTGGGTCTTGTGGCGGCTGCTGGTGCCCGAGTGG
CGGCTATGCGGCAACCAAGACGGTGCCGAGGACGGTCCCAAGTCTCGCCACGATGAGGCACACGAGCTTTTCCGG
TGGCATGACATGAGGCTTGTTGTCGAGACGGCTTGGTTTGCCGTCATCAACCTGGCGACTTGCTACGTCTTCATC
GCTAAGCCTTTTATATGGAGAGACGAAGCCGGGGGCGTACTGGATAACGGTCGGCTGCAGCGGTTTATGTGG
Transcript >Ophio5|5843
ATGGACCTCTTGCCATGGGCTGTAGCCGCCAGCGCGTGTGACGAGGTGTTTCATATACCCCAGGCTCAAAGATAT
TGTCATGGAAGATTCGGCGAGTGGGACGATAAGATTACGACGCCTCCTGGCCTCTATCTACTGTCCAATCTGCTC
CCACAGGCTTTCAACGTGACAGGACTGAGCTGGACTCACAGCTGCGAACCAAATAGTCTTCGTGCCTTCAATCTC
GTCGGCTTGGCCGTACTAGCCTACTTATTCCTGCTCTGCCGGCGCCGGATCGAAGAGCGCCTCTCGCCAACACAG
CAGCAGCCTCCGACGAGATTCGCCATTCACTCGGCCTGCAATGTCGCCCTGTTTCCCTTGTTGTTCTTCTTCTCC
GGACTGTACTACACGGACGTCGCCTCTACCGCCGTTGTACTTGCTGCCTTTCTCAACCACCTCAATCGCGTGGCT
CGCGACCGCAGCTCTACGAAGAGTGATCTTTTCACCGTCGCGCTGGGGCTTTTAGCCCTTCTCATGCGTCAGACC
AACGTATTCTGGGCCGTCGTGTACATGGGCGGCATGGAAGTCGTGCACGCCATCACGACTATGAAATCAGAGTCG
AAGCATCCGCCTGTCATGAATGGCCGAATCGACCAACTCCTGTTTATGATTCGAGAGTACTCCATTGGTCGCGTC
CACGACCCGCCTCTATGTAAGGCTAAAATGGATGATACACTCCTCACGGCCTTCAGCTTCGGAATTGCCGCCTTA
TGCAATCCCATTCGGGTATTGAGGCAGATCTGGCCATACATGACGGTTCTTGGAGCCTTTGTTGTCTTTGTCGTC
TGGAACGGAGCCGTTGTTCTCGGGGACAAGTCGAACCATGTGGCCACCATCCACTTTGCTCAGTTACTCTATATG
TGGCCCTTGTTTGTCTTCTTTTCGTGGCCCTTGCTGCTGCCGCAAGCTCTCGGCCTTGATGCGGGCCTGAGAACA
TTCTTGACGTCGGTTTTGAATGCACGGTGGGCTACAGCCAGGAAAGAAAACGACACCAGGAAGCACGCGCTATCT
GATGCTACGCCCAAACGACGGCGATCTCAAATACAAAAAACTTCACAGAAGGCTGAGCGTCTGAGGAACCTCCTC
TGGATAATCTGCTTTCTGGGAGCCATCCTGCTTTGTTGCGCCATAGTGCGATTCAACACCATCATTCACCCGTTC
ACGTTGGCCGACAACCGACACTATATGTTCTACGTCTTTCGATATTCGATCGGTCGCGCATCATGGATTAGGTAC
ACGCTAGTCGGACCGTACTTGCTGAGCTGTAATATGATCATGAGTGCCATGGCAGGATACAGCAAAGGGTGCCAG
GAGGCGAGCCGTGCGTCTCATAGCCAACTGCCACCTGCTCCCCCAAGGACCAACTTCATCCATGACGCGGAGTCA
GAAGATTCCGAAGTCGACGAAGACGCCGAGGAGGCTGGGAAGATGCGGCACCCAGGCAAGCCCTTGCGACCCAAC
CCGCTTCGTCACTTGCCGTCTCTGCCATACACCTCCACCGGCCTCATCTGGCTGTTGGCTACAAGTCTCTCCCTG
GTGACGGCGCCGTTGGTCGAGCCGCGGTACTTTATCGCGCCTTGGGTCTTGTGGCGGCTGCTGGTGCCCGAGTGG
CGGCTATGCGGCAACCAAGACGGTGCCGAGGACGGTCCCAAGTCTCGCCACGATGAGGCACACGAGCTTTTCCGG
TGGCATGACATGAGGCTTGTTGTCGAGACGGCTTGGTTTGCCGTCATCAACCTGGCGACTTGCTACGTCTTCATC
GCTAAGCCTTTTATATGGAGAGACGAAGCCGGGGGCGTACTGGATAACGGTCGGCTGCAGCGGTTTATGTGGTGA
Gene >Ophio5|5843
ATGGACCTCTTGCCATGGGCTGTAGCCGCCAGCGCGTGTGTATGGCTAGGCACCGTCTCCAGGGCCGTCCCTGAG
CCGTACATGGTGTTTGATGGCCTTGCTCAGTGAGTGTGAGCTAGCTAACGGCAAACCAGGACGAGGTGTTTCATA
TACCCCAGGCTCAAAGATATTGTCATGGAAGATTCGGCGAGTGGGACGATAAGATTACGACGCCTCCTGGCCTGT
GAGCTCACCATTGCCCGAGGAATCGAGACGCTGGCTTCTAACGCGAGCAGCTATCTACTGTCCAATCTGCTCCCA
CAGGCTTTCAACGTGACAGGACTGAGCTGGACTCACAGCTGCGAACCAAATAGTCTTCGTGCCTTCAATCTCGTC
GGCTTGGCCGTACTAGCCTACTTATTCCTGCTCTGCCGGCGCCGGATCGAAGAGCGCCTCTCGCCAACACAGCAG
CAGCCTCCGACGAGATTCGCCATTCACTCGGCCTGCAATGTCGCCCTGTTTCCCTTGTTGTTCTTCTTCTCCGGA
CTGTACTACACGGACGTCGCCTCTACCGCCGTTGTACTTGCTGCCTTTCTCAACCACCTCAATCGCGTGGCTCGC
GACCGCAGCTCTACGAAGAGTGATCTTTTCACCGTCGCGCTGGGGCTTTTAGCCCTTCTCATGCGTCAGACCAAC
GTATTCTGGGCCGTCGTGTACATGGGCGGCATGGAAGTCGTGCACGCCATCACGACTATGAAATCAGAGTCGAAG
CATCCGCCTGTCATGAATGGCCGAATCGACCAACTCCTGTTTATGATTCGAGAGTACTCCATTGGTCGCGTCCAC
GACCCGCCTCTATGTAAGGCTAAAATGGATGGTAAGCGCTGAACTGTGCAGCTTCTCCCGTCATGGCTGCTGAGT
CCCGTGACAGATACACTCCTCACGGCCTTCAGCTTCGGAATTGCCGCCTTATGCAATCCCATTCGGGTATTGAGG
CAGATCTGGCCATACATGACGGTTCTTGGAGCCTTTGTTGTCTTTGTCGTCTGGAACGGAGCCGTTGTTCTCGGT
AAGACTCTGTTTGAAGCTCACCAAAGGTTCTGAACCCTGATAAAGCACAGGGGACAAGTCGAACCATGTGGCCAC
CATCCACTTTGCTCAGTTACTCTATATGTGGCCCTTGTTTGTCTTCTTTTCGTGGCCCTTGCTGCTGCCGCAAGC
TCTCGGCCTTGATGCGGGCCTGAGAACATTCTTGACGTCGGTTTTGAATGCACGGTGGGCTACAGCCAGGAAAGA
AAACGACACCAGGAAGCACGCGCTATCTGATGCTACGCCCAAACGACGGCGATCTCAAATACAAAAAACTTCACA
GAAGGCTGAGCGTCTGAGGAACCTCCTCTGGATAATCTGCTTTCTGGGAGCCATCCTGCTTTGTTGCGCCATAGT
GCGATTCAACACCATCATTCACCCGTTCACGTTGGCCGACAACCGACACTATATGTTCTACGTCTTTCGATATTC
GATCGGTCGCGCATCATGGATTAGGTACACGCTAGTCGGACCGTACTTGCTGAGCTGTAATATGATCATGAGTGC
CATGGCAGGATACAGCAAAGGGTGCCAGGAGGCGAGCCGTGCGTCTCATAGCCAACTGCCACCTGCTCCCCCAAG
GACCAACTTCATCCATGACGCGGAGTCAGAAGATTCCGAAGTCGACGAAGACGCCGAGGAGGCTGGGAAGATGCG
GCACCCAGGCAAGCCCTTGCGACCCAACCCGCTTCGTCACTTGCCGTCTCTGCCATACACCTCCACCGGCCTCAT
CTGGCTGTTGGCTACAAGTCTCTCCCTGGTGACGGCGCCGTTGGTCGAGCCGCGGTACTTTATCGCGCCTTGGGT
CTTGTGGCGGCTGCTGGTGCCCGAGTGGCGGCTATGCGGCAACCAAGACGGTGCCGAGGACGGTCCCAAGTCTCG
CCACGATGAGGCACACGAGCTTTTCCGGTGGCATGACATGAGGCTTGTTGTCGAGACGGCTTGGTTTGCCGTCAT
CAACCTGGCGACTTGCTACGTCTTCATCGCTAAGCCTTTTATATGGAGAGACGAAGCCGGGGGCGTACTGGATAA
CGGTCGGCTGCAGCGGTTTATGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail