Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5832
Gene name
Locationscaffold_49:33417..34677
Strand-
Gene length (bp)1260
Transcript length (bp)1260
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05546 She9_MDM33 She9 / Mdm33 family 1.2E-80 109 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9I1|SHE9_NEUCR Sensitive to high expression protein 9 homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=she-9 PE=3 SV=1 85 417 3.0E-102
sp|A7EEA6|SHE9_SCLS1 Sensitive to high expression protein 9 homolog, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=she9 PE=3 SV=1 96 419 8.0E-71
sp|Q1E9R5|SHE9_COCIM Sensitive to high expression protein 9 homolog, mitochondrial OS=Coccidioides immitis (strain RS) GN=SHE9 PE=3 SV=2 89 417 2.0E-68
sp|Q0CFC0|SHE9_ASPTN Sensitive to high expression protein 9 homolog, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=she9 PE=3 SV=1 90 417 5.0E-67
sp|A1DEC4|SHE9_NEOFI Sensitive to high expression protein 9 homolog, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=she9 PE=3 SV=1 88 417 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9I1|SHE9_NEUCR Sensitive to high expression protein 9 homolog, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=she-9 PE=3 SV=1 85 417 3.0E-102
sp|A7EEA6|SHE9_SCLS1 Sensitive to high expression protein 9 homolog, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=she9 PE=3 SV=1 96 419 8.0E-71
sp|Q1E9R5|SHE9_COCIM Sensitive to high expression protein 9 homolog, mitochondrial OS=Coccidioides immitis (strain RS) GN=SHE9 PE=3 SV=2 89 417 2.0E-68
sp|Q0CFC0|SHE9_ASPTN Sensitive to high expression protein 9 homolog, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=she9 PE=3 SV=1 90 417 5.0E-67
sp|A1DEC4|SHE9_NEOFI Sensitive to high expression protein 9 homolog, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=she9 PE=3 SV=1 88 417 3.0E-66
sp|A2R3F3|SHE9_ASPNC Sensitive to high expression protein 9 homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=she9 PE=3 SV=1 97 418 2.0E-64
sp|Q4WV30|SHE9_ASPFU Sensitive to high expression protein 9 homolog, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=she9 PE=3 SV=1 88 417 5.0E-64
sp|Q5BAW7|SHE9_EMENI Sensitive to high expression protein 9 homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=she9 PE=3 SV=1 97 304 2.0E-63
sp|A1CB06|SHE9_ASPCL Sensitive to high expression protein 9 homolog, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=she9 PE=3 SV=1 97 304 2.0E-62
sp|Q6C7F7|SHE9_YARLI Sensitive to high expression protein 9 homolog, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SHE9 PE=3 SV=1 93 300 1.0E-56
sp|Q6BJ94|SHE9_DEBHA Sensitive to high expression protein 9 homolog, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SHE9 PE=3 SV=2 97 287 3.0E-56
sp|Q2TWP5|SHE9_ASPOR Sensitive to high expression protein 9 homolog, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=she9 PE=3 SV=1 116 417 2.0E-53
sp|Q5A0L7|SHE9_CANAL Sensitive to high expression protein 9 homolog, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHE9 PE=3 SV=1 97 298 6.0E-53
sp|A6QU86|SHE9_AJECN Sensitive to high expression protein 9 homolog, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SHE9 PE=3 SV=1 135 417 2.0E-51
sp|A5DI86|SHE9_PICGU Sensitive to high expression protein 9 homolog, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SHE9 PE=3 SV=2 97 301 5.0E-51
sp|A5DVB1|SHE9_LODEL Sensitive to high expression protein 9 homolog, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SHE9 PE=3 SV=1 97 321 1.0E-50
sp|A6ZYZ4|SHE9_YEAS7 Sensitive to high expression protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=SHE9 PE=3 SV=1 91 304 1.0E-47
sp|Q04172|SHE9_YEAST Sensitive to high expression protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHE9 PE=1 SV=1 78 304 1.0E-47
sp|Q6CUA2|SHE9_KLULA Sensitive to high expression protein 9 homolog, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHE9 PE=3 SV=1 86 388 7.0E-47
sp|Q9P6N3|SHE9_SCHPO Sensitive to high expression protein 9 homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=she9 PE=3 SV=1 84 331 1.0E-46
sp|Q6FK33|SHE9_CANGA Sensitive to high expression protein 9 homolog, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHE9 PE=3 SV=1 96 309 5.0E-45
sp|A7THM1|SHE9_VANPO Sensitive to high expression protein 9 homolog, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SHE9 PE=3 SV=1 92 297 8.0E-44
sp|Q753C3|SHE9_ASHGO Sensitive to high expression protein 9 homolog, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHE9 PE=3 SV=1 88 317 8.0E-42
sp|P0CR46|SHE9_CRYNJ Sensitive to high expression protein 9 homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SHE9 PE=3 SV=1 115 315 1.0E-32
sp|P0CR47|SHE9_CRYNB Sensitive to high expression protein 9 homolog, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SHE9 PE=3 SV=1 115 315 2.0E-32
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 256 278 22
2 394 416 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5832
MSLMDSGGQSGGCLKVGRKSKIICHDREGGPRRHWQRTSDDTSSRLRLNPMPPSGRRVVRAAWPQVSCLQHDVSI
WLRRSYTTQPLSKNDSAVASELPSAMEDRRSALNRKLGNVMDNLQSRVLTASHTLNDITGYSAIETIKTENQNLE
NRLATAQERVRTARQAYRSSNTKRSATQREVTTLLARKDSWLPVDLERFTELYRADHVLEGEVTAAQETLMEAEA
DEQRLSQRLNAGILKRYHEEQIWSDRIRRASTWGTWGLMGMNFVLFVVLQFVAEPWRRRRLVRGVVEEERGVLQE
VRDELGAVKLGLTRMADGEGRPQEARAEAVEVVETDSLGFESIHQEEVTGPPARDHVATTLTWRDVLLQPRRWRA
AAADLYSERRLDLRMRDASMIAVEGALAGAAVAGGLALALMRRT
Coding >Ophio5|5832
ATGTCTCTAATGGACTCGGGCGGTCAGTCGGGGGGTTGTTTGAAGGTTGGCAGAAAGAGCAAAATCATCTGCCAC
GACCGTGAAGGGGGACCTCGCCGCCATTGGCAGCGAACATCGGACGATACGAGCTCGAGACTCCGTTTAAATCCC
ATGCCGCCGTCTGGCCGCCGGGTCGTGCGGGCCGCCTGGCCGCAGGTCTCTTGTCTTCAGCACGACGTCTCGATA
TGGCTTCGGCGGTCTTACACGACACAGCCGTTGTCCAAGAATGACTCGGCCGTAGCTTCGGAGCTGCCGTCGGCG
ATGGAGGACCGGCGGAGCGCGCTGAACCGGAAGCTTGGCAACGTCATGGACAACTTGCAGTCGCGGGTCCTCACG
GCGTCACACACGCTCAACGACATCACGGGATACTCGGCCATCGAGACCATCAAGACCGAGAACCAGAATCTCGAG
AACCGGCTGGCGACGGCGCAGGAACGAGTGCGCACGGCGCGACAGGCTTACCGCTCGTCCAACACGAAGCGCTCG
GCCACGCAGCGCGAGGTGACGACGCTGCTGGCGCGCAAGGACAGCTGGCTGCCCGTCGATCTTGAGCGCTTCACC
GAGCTGTACCGGGCGGACCACGTGCTCGAGGGTGAGGTGACGGCCGCGCAGGAGACGCTGATGGAAGCTGAGGCC
GACGAGCAGAGGCTCAGCCAACGGCTCAACGCCGGCATCCTCAAGCGCTACCACGAGGAGCAGATCTGGAGCGAT
AGGATACGCAGGGCCAGCACCTGGGGCACATGGGGTCTCATGGGCATGAATTTCGTGCTCTTTGTCGTCTTGCAG
TTTGTTGCCGAGCCGTGGCGCAGGCGGAGGCTCGTCAGGGGCGTTGTTGAGGAGGAAAGGGGCGTGCTGCAGGAG
GTGCGGGACGAGCTTGGTGCCGTGAAGCTGGGGCTGACGAGGATGGCTGACGGCGAGGGGAGGCCGCAAGAGGCG
AGAGCCGAGGCAGTCGAGGTCGTCGAGACGGATAGCCTCGGGTTTGAAAGCATCCACCAAGAAGAAGTGACAGGG
CCGCCTGCGAGAGACCATGTCGCGACGACACTGACGTGGAGAGATGTGCTGCTACAGCCAAGGCGGTGGAGGGCG
GCGGCGGCGGACCTGTACAGCGAGAGACGGTTGGATTTGCGGATGAGAGACGCCTCGATGATCGCGGTCGAGGGG
GCGCTGGCGGGGGCGGCTGTTGCTGGGGGGCTGGCCTTGGCTCTGATGCGGCGGACA
Transcript >Ophio5|5832
ATGTCTCTAATGGACTCGGGCGGTCAGTCGGGGGGTTGTTTGAAGGTTGGCAGAAAGAGCAAAATCATCTGCCAC
GACCGTGAAGGGGGACCTCGCCGCCATTGGCAGCGAACATCGGACGATACGAGCTCGAGACTCCGTTTAAATCCC
ATGCCGCCGTCTGGCCGCCGGGTCGTGCGGGCCGCCTGGCCGCAGGTCTCTTGTCTTCAGCACGACGTCTCGATA
TGGCTTCGGCGGTCTTACACGACACAGCCGTTGTCCAAGAATGACTCGGCCGTAGCTTCGGAGCTGCCGTCGGCG
ATGGAGGACCGGCGGAGCGCGCTGAACCGGAAGCTTGGCAACGTCATGGACAACTTGCAGTCGCGGGTCCTCACG
GCGTCACACACGCTCAACGACATCACGGGATACTCGGCCATCGAGACCATCAAGACCGAGAACCAGAATCTCGAG
AACCGGCTGGCGACGGCGCAGGAACGAGTGCGCACGGCGCGACAGGCTTACCGCTCGTCCAACACGAAGCGCTCG
GCCACGCAGCGCGAGGTGACGACGCTGCTGGCGCGCAAGGACAGCTGGCTGCCCGTCGATCTTGAGCGCTTCACC
GAGCTGTACCGGGCGGACCACGTGCTCGAGGGTGAGGTGACGGCCGCGCAGGAGACGCTGATGGAAGCTGAGGCC
GACGAGCAGAGGCTCAGCCAACGGCTCAACGCCGGCATCCTCAAGCGCTACCACGAGGAGCAGATCTGGAGCGAT
AGGATACGCAGGGCCAGCACCTGGGGCACATGGGGTCTCATGGGCATGAATTTCGTGCTCTTTGTCGTCTTGCAG
TTTGTTGCCGAGCCGTGGCGCAGGCGGAGGCTCGTCAGGGGCGTTGTTGAGGAGGAAAGGGGCGTGCTGCAGGAG
GTGCGGGACGAGCTTGGTGCCGTGAAGCTGGGGCTGACGAGGATGGCTGACGGCGAGGGGAGGCCGCAAGAGGCG
AGAGCCGAGGCAGTCGAGGTCGTCGAGACGGATAGCCTCGGGTTTGAAAGCATCCACCAAGAAGAAGTGACAGGG
CCGCCTGCGAGAGACCATGTCGCGACGACACTGACGTGGAGAGATGTGCTGCTACAGCCAAGGCGGTGGAGGGCG
GCGGCGGCGGACCTGTACAGCGAGAGACGGTTGGATTTGCGGATGAGAGACGCCTCGATGATCGCGGTCGAGGGG
GCGCTGGCGGGGGCGGCTGTTGCTGGGGGGCTGGCCTTGGCTCTGATGCGGCGGACATGA
Gene >Ophio5|5832
ATGTCTCTAATGGACTCGGGCGGTCAGTCGGGGGGTTGTTTGAAGGTTGGCAGAAAGAGCAAAATCATCTGCCAC
GACCGTGAAGGGGGACCTCGCCGCCATTGGCAGCGAACATCGGACGATACGAGCTCGAGACTCCGTTTAAATCCC
ATGCCGCCGTCTGGCCGCCGGGTCGTGCGGGCCGCCTGGCCGCAGGTCTCTTGTCTTCAGCACGACGTCTCGATA
TGGCTTCGGCGGTCTTACACGACACAGCCGTTGTCCAAGAATGACTCGGCCGTAGCTTCGGAGCTGCCGTCGGCG
ATGGAGGACCGGCGGAGCGCGCTGAACCGGAAGCTTGGCAACGTCATGGACAACTTGCAGTCGCGGGTCCTCACG
GCGTCACACACGCTCAACGACATCACGGGATACTCGGCCATCGAGACCATCAAGACCGAGAACCAGAATCTCGAG
AACCGGCTGGCGACGGCGCAGGAACGAGTGCGCACGGCGCGACAGGCTTACCGCTCGTCCAACACGAAGCGCTCG
GCCACGCAGCGCGAGGTGACGACGCTGCTGGCGCGCAAGGACAGCTGGCTGCCCGTCGATCTTGAGCGCTTCACC
GAGCTGTACCGGGCGGACCACGTGCTCGAGGGTGAGGTGACGGCCGCGCAGGAGACGCTGATGGAAGCTGAGGCC
GACGAGCAGAGGCTCAGCCAACGGCTCAACGCCGGCATCCTCAAGCGCTACCACGAGGAGCAGATCTGGAGCGAT
AGGATACGCAGGGCCAGCACCTGGGGCACATGGGGTCTCATGGGCATGAATTTCGTGCTCTTTGTCGTCTTGCAG
TTTGTTGCCGAGCCGTGGCGCAGGCGGAGGCTCGTCAGGGGCGTTGTTGAGGAGGAAAGGGGCGTGCTGCAGGAG
GTGCGGGACGAGCTTGGTGCCGTGAAGCTGGGGCTGACGAGGATGGCTGACGGCGAGGGGAGGCCGCAAGAGGCG
AGAGCCGAGGCAGTCGAGGTCGTCGAGACGGATAGCCTCGGGTTTGAAAGCATCCACCAAGAAGAAGTGACAGGG
CCGCCTGCGAGAGACCATGTCGCGACGACACTGACGTGGAGAGATGTGCTGCTACAGCCAAGGCGGTGGAGGGCG
GCGGCGGCGGACCTGTACAGCGAGAGACGGTTGGATTTGCGGATGAGAGACGCCTCGATGATCGCGGTCGAGGGG
GCGCTGGCGGGGGCGGCTGTTGCTGGGGGGCTGGCCTTGGCTCTGATGCGGCGGACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail