Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|583
Gene name
Locationscaffold_115:34374..35142
Strand+
Gene length (bp)768
Transcript length (bp)627
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04387 PTPLA Protein tyrosine phosphatase-like protein, PTPLA 1.2E-53 53 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14346|HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C2.15c PE=3 SV=2 7 202 7.0E-43
sp|Q8VZB2|HACD_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 OS=Arabidopsis thaliana GN=PAS2 PE=1 SV=1 7 202 2.0E-37
sp|P40857|HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHS1 PE=1 SV=1 9 205 8.0E-36
sp|Q5ZEJ0|HACDB_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2B OS=Oryza sativa subsp. japonica GN=PAS2B PE=2 SV=1 10 192 9.0E-35
sp|Q7XSZ4|HACDA_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A OS=Oryza sativa subsp. japonica GN=PAS2A PE=2 SV=2 10 192 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14346|HACD_SCHPO Probable very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C2.15c PE=3 SV=2 7 202 7.0E-43
sp|Q8VZB2|HACD_ARATH Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 OS=Arabidopsis thaliana GN=PAS2 PE=1 SV=1 7 202 2.0E-37
sp|P40857|HACD_YEAST Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHS1 PE=1 SV=1 9 205 8.0E-36
sp|Q5ZEJ0|HACDB_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2B OS=Oryza sativa subsp. japonica GN=PAS2B PE=2 SV=1 10 192 9.0E-35
sp|Q7XSZ4|HACDA_ORYSJ Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2A OS=Oryza sativa subsp. japonica GN=PAS2A PE=2 SV=2 10 192 1.0E-34
sp|O17040|HACD_CAEEL Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 OS=Caenorhabditis elegans GN=hpo-8 PE=3 SV=2 10 204 2.0E-27
sp|Q9QY80|HACD1_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Mus musculus GN=Hacd1 PE=2 SV=1 8 204 2.0E-26
sp|B0YJ81|HACD1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Homo sapiens GN=HACD1 PE=1 SV=1 8 204 2.0E-25
sp|Q4W1W1|HACD1_CANLF Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Canis lupus familiaris GN=HACD1 PE=2 SV=1 8 204 4.0E-25
sp|Q9N1R5|HACD1_SHEEP Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 OS=Ovis aries GN=HACD1 PE=2 SV=1 8 204 4.0E-24
sp|Q2KIP8|HACD2_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Bos taurus GN=HACD2 PE=2 SV=2 4 204 6.0E-24
sp|Q6Y1H2|HACD2_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Homo sapiens GN=HACD2 PE=1 SV=1 4 204 1.0E-23
sp|Q5RBK3|HACD2_PONAB Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Pongo abelii GN=HACD2 PE=2 SV=1 4 204 1.0E-23
sp|Q9D3B1|HACD2_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 OS=Mus musculus GN=Hacd2 PE=1 SV=1 4 204 1.0E-23
sp|Q5ZM57|HACD3_CHICK Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Gallus gallus GN=HACD3 PE=2 SV=1 7 158 2.0E-14
sp|A2AKM2|HACD4_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus GN=Hacd4 PE=2 SV=2 44 203 1.0E-11
sp|Q8K2C9|HACD3_MOUSE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus GN=Hacd3 PE=1 SV=2 7 202 1.0E-11
sp|A7YY55|HACD3_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Bos taurus GN=HACD3 PE=2 SV=1 7 202 3.0E-11
sp|Q5NVQ2|HACD3_PONAB Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Pongo abelii GN=HACD3 PE=2 SV=1 7 202 3.0E-11
sp|Q9P035|HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens GN=HACD3 PE=1 SV=2 7 202 3.0E-11
sp|Q5VWC8|HACD4_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Homo sapiens GN=HACD4 PE=1 SV=1 7 205 8.0E-11
sp|Q7SY06|HACD3_DANRE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Danio rerio GN=hacd3 PE=2 SV=2 7 191 5.0E-10
sp|Q6GNB5|HACD4_XENLA Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Xenopus laevis GN=hacd4 PE=2 SV=1 44 176 3.0E-09
sp|Q0P5C7|HACD4_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Bos taurus GN=HACD4 PE=2 SV=1 7 204 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 113 135 22
4 140 158 18
5 168 190 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 125.14 67.40 182.89
CcL In ants, during behavior modification 62.76 28.68 96.83
CcD In ants, recently dead 47.39 21.08 73.70

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.005499 yes
SC16a CcD 0.000770 yes
CcL CcD 0.342072 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|583
MASSPGKTAYLILFNAASAVAWAVVLCRTVTIFSVLGPLFVYDGVGVWTKWTQTLAALEVLHSLLGIVRAPFFTT
LMQVSSRFLLVWAIVDRFPFLALSPAYSSMLVAWSSSEVIRYSYFTLSLSGFAPSFLTWLRYSTFWVFYPIGILS
ECVLIYKASAHCVPLERYTLYAVLAIYVPGSYVLYSHMIAQRRKVMRSLKAKDDRATR
Coding >Ophio5|583
ATGGCCTCGTCCCCGGGAAAGACGGCCTATCTTATCCTCTTCAACGCCGCGTCGGCCGTGGCCTGGGCCGTTGTT
CTCTGTCGCACCGTCACCATCTTCTCTGTTCTCGGTCCTCTCTTCGTCTACGATGGCGTCGGGGTCTGGACGAAG
TGGACGCAGACGCTCGCCGCCCTCGAGGTGCTGCACTCGCTACTCGGCATCGTCCGAGCCCCCTTCTTTACCACT
CTTATGCAGGTCTCTTCGCGCTTCCTCCTCGTCTGGGCCATCGTTGATCGCTTTCCCTTCCTCGCCCTCTCCCCC
GCCTACTCGTCCATGCTCGTCGCCTGGTCTAGCTCCGAGGTCATCCGTTACTCCTACTTTACTCTTTCTCTGTCC
GGGTTTGCGCCCTCATTCCTTACCTGGCTGCGCTATAGCACCTTCTGGGTCTTTTACCCCATCGGCATCCTGAGC
GAGTGCGTCCTCATCTACAAGGCTTCCGCTCACTGCGTACCCCTCGAGCGGTATACGCTCTACGCCGTTCTCGCC
ATCTACGTCCCTGGATCCTACGTCCTCTACTCGCACATGATTGCCCAGCGGAGAAAGGTGATGCGCTCTCTCAAG
GCCAAGGATGACAGGGCAACCCGT
Transcript >Ophio5|583
ATGGCCTCGTCCCCGGGAAAGACGGCCTATCTTATCCTCTTCAACGCCGCGTCGGCCGTGGCCTGGGCCGTTGTT
CTCTGTCGCACCGTCACCATCTTCTCTGTTCTCGGTCCTCTCTTCGTCTACGATGGCGTCGGGGTCTGGACGAAG
TGGACGCAGACGCTCGCCGCCCTCGAGGTGCTGCACTCGCTACTCGGCATCGTCCGAGCCCCCTTCTTTACCACT
CTTATGCAGGTCTCTTCGCGCTTCCTCCTCGTCTGGGCCATCGTTGATCGCTTTCCCTTCCTCGCCCTCTCCCCC
GCCTACTCGTCCATGCTCGTCGCCTGGTCTAGCTCCGAGGTCATCCGTTACTCCTACTTTACTCTTTCTCTGTCC
GGGTTTGCGCCCTCATTCCTTACCTGGCTGCGCTATAGCACCTTCTGGGTCTTTTACCCCATCGGCATCCTGAGC
GAGTGCGTCCTCATCTACAAGGCTTCCGCTCACTGCGTACCCCTCGAGCGGTATACGCTCTACGCCGTTCTCGCC
ATCTACGTCCCTGGATCCTACGTCCTCTACTCGCACATGATTGCCCAGCGGAGAAAGGTGATGCGCTCTCTCAAG
GCCAAGGATGACAGGGCAACCCGTTGA
Gene >Ophio5|583
ATGGCCTCGTCCCCGGGAAAGACGGCCTATCTTATCCTCTTCAACGCCGCGTCGGCCGTGGCCTGGGCCGTTGTT
CTCTGTCGCACCGTCACCATCTTCTCTGTTCTCGGTCCTCTCTTCGTCTACGATGGCGTCGGGGTCTGGACGAAG
TGGACGCAGACGCTCGCCGCCCTCGAGGTGCTGCACTCGCTACTCGGTCCGTTCCCCCCCCCCCCCCCCCCCCCC
CCCCTTGAACATCTAGACCACATAACCAAGGCCGCTGACGCGCTTCCTGGAAAAAGGCATCGTCCGAGCCCCCTT
CTTTACCACTCTTATGCAGGTCTCTTCGCGCTTCCTCCTCGTCTGGGCCATCGTTGATCGCTTTCCCTTCCTCGC
CCTCTCCCCCGCCTACTCGTCCATGCTCGTCGCCTGGTCTAGCTCCGAGGTCATCCGTTACTCCTACTTTACTCT
TTCTCTGTCCGGGTTTGCGCCCTCATTCCTTACCTGGCTGCGCTATAGCACCTTCTGGGTCTTTTACCCCATCGG
CATCCTGAGCGAGTGCGTCCTCATCTACAAGGCTTCCGCTCACTGCGTACCCCTCGAGCGGTATACGCTCTACGC
CGTTCTCGCCATCTACGTCCCTGGTACGTGTCCACCGCTTCTCCTCTTGGTGATGCCATCTTTCTGAAGCCACTC
TCAGGATCCTACGTCCTCTACTCGCACATGATTGCCCAGCGGAGAAAGGTGATGCGCTCTCTCAAGGCCAAGGAT
GACAGGGCAACCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail