Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5823
Gene name
Locationscaffold_49:13996..15976
Strand-
Gene length (bp)1980
Transcript length (bp)1788
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 1.3E-171 99 551

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 595 7.0E-153
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 19 595 1.0E-152
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 18 595 7.0E-152
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 13 595 6.0E-148
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 13 595 9.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 595 7.0E-153
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 19 595 1.0E-152
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 18 595 7.0E-152
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 13 595 6.0E-148
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 13 595 9.0E-147
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 13 595 2.0E-146
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 13 595 3.0E-146
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 16 595 1.0E-144
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 19 595 2.0E-144
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 10 595 7.0E-140
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 17 595 3.0E-138
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 19 595 3.0E-133
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 127 595 5.0E-132
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 127 595 5.0E-132
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 10 595 6.0E-132
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 10 595 1.0E-131
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 20 595 2.0E-131
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 15 595 2.0E-131
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 163 595 1.0E-101
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 30 595 7.0E-94
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 152 595 2.0E-93
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 14 595 2.0E-91
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 1 595 6.0E-90
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 186 595 1.0E-86
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 186 595 1.0E-86
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 29 595 1.0E-80
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 28 595 5.0E-77
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 23 595 1.0E-76
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 23 595 6.0E-76
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 23 595 7.0E-76
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 30 595 1.0E-75
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 28 595 5.0E-69
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 26 595 1.0E-64
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 133 595 3.0E-48
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 70 589 4.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 221 243 22
2 300 322 22
3 329 351 22
4 366 388 22
5 395 417 22
6 458 480 22
7 485 507 22
8 522 544 22
9 557 579 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 108.96 57.80 160.12
CcL In ants, during behavior modification 125.43 64.47 186.39
CcD In ants, recently dead 122.42 64.15 180.68

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.591228 no
SC16a CcD 0.662019 no
CcL CcD 0.934424 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5823
MHLRTALAALLAAPQMASAFYLPGVAPTSYKPGDSVPLQVNSIRPVAAPQDNRLHSVVSYDYYHPDFHFCEPPGG
PQMRRASLYAKPRILSTARAGQQIKDDLTGTTFYSPGFQLGGFFLSSDEEEEELSFNNHYEIWIEYHPVNGRENE
LRVVGAVVQPSSKMYTGEVDCADGHPPVSLTFGDEDQQVQFSYSVYWRKSETAWATRWDKYLHVFDPKIHWFWLI
DTAVIVVILVLTVMSVLVRTLKKDIARYNRLDQISLDDLSGTSVVEEGVQEDSGWKLIHGDVFRTPPHPLLLSVL
LGNGAQLFVMTGCTIVFALLGFLSPSNRGSLGTIMIILYTLLGSVGGYASARTYKALLGEQWKLNIALTPLLVPG
IVFGAFFLLDLFLWAKRSSGAVPFTTMLVIIAIWFVISIPLSFVGSWMGFRSPQLEAPVRTNQIPRQIPPATTYL
QPIPSMLIVGLLPFGAIFVELYFIMSSIWFSRIYYMFGFLFLCYGLMIVVCAAVTILMTYFLLCAENYNWQWRSF
LAAGMSGGYIFLNCLLYLLTKVKLGGLAGVVLYVGYSALISFLFFILAGSIGYFASWWFVRKIYSSIKID
Coding >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGCTGGCCAGCAGATCAAA
GACGACTTGACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAG
GAGGAGGAGCTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAG
CTCCGTGTCGTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCAT
CCGCCCGTCTCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCA
GAAACGGCCTGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATC
GACACGGCCGTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATT
GCGCGGTACAACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAG
GAAGACTCGGGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTA
CTCGGAAATGGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCG
TCGAACCGCGGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCG
GCCAGGACCTACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGC
ATCGTCTTTGGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACA
ACCATGCTCGTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTT
CGGAGCCCGCAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTT
CAGCCGATTCCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATG
AGCTCTATCTGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTC
TGCGCCGCCGTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGC
GGGCTCGCAGGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGCTCC
ATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGGAAGATTTACTCCTCCATCAAAATTGAC
Transcript >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGCTGGCCAGCAGATCAAA
GACGACTTGACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAG
GAGGAGGAGCTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAG
CTCCGTGTCGTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCAT
CCGCCCGTCTCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCA
GAAACGGCCTGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATC
GACACGGCCGTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATT
GCGCGGTACAACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAG
GAAGACTCGGGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTA
CTCGGAAATGGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCG
TCGAACCGCGGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCG
GCCAGGACCTACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGC
ATCGTCTTTGGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACA
ACCATGCTCGTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTT
CGGAGCCCGCAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTT
CAGCCGATTCCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATG
AGCTCTATCTGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTC
TGCGCCGCCGTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGC
GGGCTCGCAGGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGCTCC
ATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGGAAGATTTACTCCTCCATCAAAATTGACTAG
Gene >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAGTACGTGCCCGAGAGCCTGGGGAGCATCCTCTCGGGCGACAGGCTGATGACGTCGCCCTTTGAGCTGCTC
ATGGCCAAGAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGGTTCGTCAACGAG
CGCATAGAGGAGGCTTACAGCCTCAACTGGCTCGTTGATGGCCTACCAGCTGGCCAGCAGATCAAAGACGACTTG
ACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAGGAGGAGGAG
CTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAGCTCCGTGTC
GTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCATCCGCCCGTC
TCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCAGAAACGGCC
TGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATCGACACGGCC
GTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATTGCGCGGTAC
AACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAGGAAGACTCG
GGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTACTCGGAAAT
GGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCGTCGAACCGC
GGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCGGCCAGGACC
TACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGCATCGTCTTT
GGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACAACCATGCTC
GTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTTCGGAGCCCG
CAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTTCAGCCGATT
CCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATGAGCTCTATC
TGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTCTGCGCCGCC
GTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTCCTCGCCGCC
GGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGCGGGCTCGCA
GGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGTATGCCTCTTCCA
TGATGGTCTCACCCGACCGCATCTAACGTGAATTCAGGCTCCATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGG
AAGATTTACTCCTCCATCAAAATTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail