Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5823
Gene name
Locationscaffold_49:13996..15976
Strand-
Gene length (bp)1980
Transcript length (bp)1788
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 1.3E-171 99 551

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 595 7.0E-153
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 19 595 1.0E-152
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 18 595 7.0E-152
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 13 595 6.0E-148
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 13 595 9.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 595 7.0E-153
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 19 595 1.0E-152
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 18 595 7.0E-152
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 13 595 6.0E-148
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 13 595 9.0E-147
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 13 595 2.0E-146
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 13 595 3.0E-146
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 16 595 1.0E-144
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 19 595 2.0E-144
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 10 595 7.0E-140
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 17 595 3.0E-138
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 19 595 3.0E-133
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 127 595 5.0E-132
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 127 595 5.0E-132
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 10 595 6.0E-132
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 10 595 1.0E-131
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 20 595 2.0E-131
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 15 595 2.0E-131
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 163 595 1.0E-101
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 30 595 7.0E-94
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 152 595 2.0E-93
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 14 595 2.0E-91
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 1 595 6.0E-90
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 186 595 1.0E-86
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 186 595 1.0E-86
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 29 595 1.0E-80
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 28 595 5.0E-77
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 23 595 1.0E-76
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 23 595 6.0E-76
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 23 595 7.0E-76
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 30 595 1.0E-75
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 28 595 5.0E-69
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 26 595 1.0E-64
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 133 595 3.0E-48
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 70 589 4.0E-36
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 221 243 22
2 300 322 22
3 329 351 22
4 366 388 22
5 395 417 22
6 458 480 22
7 485 507 22
8 522 544 22
9 557 579 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5823
MHLRTALAALLAAPQMASAFYLPGVAPTSYKPGDSVPLQVNSIRPVAAPQDNRLHSVVSYDYYHPDFHFCEPPGG
PQMRRASLYAKPRILSTARAGQQIKDDLTGTTFYSPGFQLGGFFLSSDEEEEELSFNNHYEIWIEYHPVNGRENE
LRVVGAVVQPSSKMYTGEVDCADGHPPVSLTFGDEDQQVQFSYSVYWRKSETAWATRWDKYLHVFDPKIHWFWLI
DTAVIVVILVLTVMSVLVRTLKKDIARYNRLDQISLDDLSGTSVVEEGVQEDSGWKLIHGDVFRTPPHPLLLSVL
LGNGAQLFVMTGCTIVFALLGFLSPSNRGSLGTIMIILYTLLGSVGGYASARTYKALLGEQWKLNIALTPLLVPG
IVFGAFFLLDLFLWAKRSSGAVPFTTMLVIIAIWFVISIPLSFVGSWMGFRSPQLEAPVRTNQIPRQIPPATTYL
QPIPSMLIVGLLPFGAIFVELYFIMSSIWFSRIYYMFGFLFLCYGLMIVVCAAVTILMTYFLLCAENYNWQWRSF
LAAGMSGGYIFLNCLLYLLTKVKLGGLAGVVLYVGYSALISFLFFILAGSIGYFASWWFVRKIYSSIKID
Coding >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGCTGGCCAGCAGATCAAA
GACGACTTGACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAG
GAGGAGGAGCTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAG
CTCCGTGTCGTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCAT
CCGCCCGTCTCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCA
GAAACGGCCTGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATC
GACACGGCCGTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATT
GCGCGGTACAACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAG
GAAGACTCGGGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTA
CTCGGAAATGGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCG
TCGAACCGCGGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCG
GCCAGGACCTACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGC
ATCGTCTTTGGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACA
ACCATGCTCGTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTT
CGGAGCCCGCAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTT
CAGCCGATTCCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATG
AGCTCTATCTGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTC
TGCGCCGCCGTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGC
GGGCTCGCAGGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGCTCC
ATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGGAAGATTTACTCCTCCATCAAAATTGAC
Transcript >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGCTGGCCAGCAGATCAAA
GACGACTTGACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAG
GAGGAGGAGCTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAG
CTCCGTGTCGTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCAT
CCGCCCGTCTCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCA
GAAACGGCCTGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATC
GACACGGCCGTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATT
GCGCGGTACAACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAG
GAAGACTCGGGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTA
CTCGGAAATGGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCG
TCGAACCGCGGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCG
GCCAGGACCTACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGC
ATCGTCTTTGGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACA
ACCATGCTCGTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTT
CGGAGCCCGCAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTT
CAGCCGATTCCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATG
AGCTCTATCTGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTC
TGCGCCGCCGTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTC
CTCGCCGCCGGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGC
GGGCTCGCAGGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGCTCC
ATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGGAAGATTTACTCCTCCATCAAAATTGACTAG
Gene >Ophio5|5823
ATGCACCTCCGAACCGCCCTCGCGGCGTTGCTGGCGGCTCCGCAGATGGCCTCGGCCTTTTATCTGCCAGGCGTT
GCGCCGACGTCTTACAAGCCCGGCGACAGCGTCCCCCTTCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCCCAA
GACAACCGTCTTCACTCGGTCGTCTCTTACGACTACTATCACCCGGACTTTCACTTCTGCGAACCCCCCGGCGGC
CCGCAGTACGTGCCCGAGAGCCTGGGGAGCATCCTCTCGGGCGACAGGCTGATGACGTCGCCCTTTGAGCTGCTC
ATGGCCAAGAATGAGACGTGCAAGCCTTTATGCAAAGCCTCGTATCCTGTCGACAGCAAGAGGTTCGTCAACGAG
CGCATAGAGGAGGCTTACAGCCTCAACTGGCTCGTTGATGGCCTACCAGCTGGCCAGCAGATCAAAGACGACTTG
ACGGGCACGACCTTTTACAGCCCTGGCTTCCAACTCGGCGGCTTCTTCCTGTCGTCTGATGAGGAGGAGGAGGAG
CTCTCGTTCAACAACCACTACGAGATATGGATCGAATATCACCCGGTAAACGGCCGGGAGAACGAGCTCCGTGTC
GTCGGCGCCGTCGTTCAACCCAGCTCCAAGATGTACACGGGCGAGGTCGACTGCGCCGACGGTCATCCGCCCGTC
TCCCTCACCTTTGGCGACGAGGACCAGCAGGTTCAGTTCAGCTACAGCGTCTACTGGCGCAAGTCAGAAACGGCC
TGGGCCACACGCTGGGACAAATATCTCCACGTCTTCGACCCCAAGATCCATTGGTTCTGGCTCATCGACACGGCC
GTCATTGTTGTCATCCTCGTCCTCACTGTCATGTCCGTGCTCGTAAGGACGCTCAAAAAGGACATTGCGCGGTAC
AACCGGTTGGACCAGATTAGTCTCGACGACCTGAGCGGCACTTCGGTGGTTGAGGAGGGCGTCCAGGAAGACTCG
GGCTGGAAGCTGATACACGGCGACGTCTTCCGCACACCGCCCCACCCCTTACTGCTATCAGTGCTACTCGGAAAT
GGCGCCCAGCTGTTCGTTATGACAGGCTGCACCATCGTCTTCGCCCTTCTTGGCTTCCTTTCCCCGTCGAACCGC
GGATCTCTGGGCACCATCATGATCATCCTCTACACCCTTCTCGGCTCCGTCGGCGGCTACGCCTCGGCCAGGACC
TACAAGGCCTTGCTCGGCGAGCAGTGGAAGCTCAACATTGCCCTGACGCCACTGCTGGTGCCTGGCATCGTCTTT
GGCGCCTTCTTCCTCCTCGACCTCTTCCTATGGGCCAAGCGATCCTCGGGCGCGGTGCCCTTTACAACCATGCTC
GTCATCATTGCCATCTGGTTCGTCATATCCATACCGCTATCCTTTGTCGGCTCGTGGATGGGTTTTCGGAGCCCG
CAACTTGAGGCGCCGGTGCGCACCAACCAGATCCCTCGACAGATACCGCCGGCCACGACATACCTTCAGCCGATT
CCCAGCATGCTCATCGTCGGCCTCCTGCCCTTTGGCGCCATCTTTGTCGAGCTATACTTCATCATGAGCTCTATC
TGGTTCAGTCGCATCTATTACATGTTTGGTTTCCTCTTCCTTTGCTATGGCCTGATGATTGTCGTCTGCGCCGCC
GTTACTATCCTCATGACCTACTTTCTCCTGTGCGCCGAAAACTATAACTGGCAATGGAGGTCGTTCCTCGCCGCC
GGCATGAGCGGCGGCTACATCTTTCTCAACTGCCTCCTCTACCTCTTGACCAAGGTGAAGCTCGGCGGGCTCGCA
GGTGTCGTGCTTTACGTCGGCTACAGCGCCCTCATCTCCTTTCTGTTCTTTATTCTGGCCGGTATGCCTCTTCCA
TGATGGTCTCACCCGACCGCATCTAACGTGAATTCAGGCTCCATTGGCTACTTTGCCAGCTGGTGGTTCGTGAGG
AAGATTTACTCCTCCATCAAAATTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail