Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5821
Gene name
Locationscaffold_49:11580..12246
Strand-
Gene length (bp)666
Transcript length (bp)267
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09796 QCR10 Ubiquinol-cytochrome-c reductase complex subunit (QCR10) 1.4E-23 26 88

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:1990204 oxidoreductase complex No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0098798 mitochondrial protein-containing complex No
GO:0045333 cellular respiration No
GO:0022904 respiratory electron transport chain No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009060 aerobic respiration No
GO:0098796 membrane protein complex No
GO:0009987 cellular process No
GO:0019646 aerobic electron transport chain No
GO:0005575 cellular_component No
GO:0098803 respiratory chain complex No
GO:0022900 electron transport chain No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0045275 respiratory chain complex III No
GO:1902495 transmembrane transporter complex No
GO:0070069 cytochrome complex No
GO:1990351 transporter complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 270.82 125.20 416.44
CcL In ants, during behavior modification 319.46 152.43 486.48
CcD In ants, recently dead 451.10 233.84 668.36

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.570292 no
SC16a CcD 0.035742 yes
CcL CcD 0.179108 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5821
MESPISRPPSFKSAYGPKYQHQPNIRGWNRTAILRLGVRAGLYGGAAGVAALLFTSGIPRIRVDIMERIPFVGRY
FVKEPVNPADNPF
Coding >Ophio5|5821
ATGGAATCTCCCATCAGCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTATCAGCATCAGCCCAACATC
CGCGGATGGAACAGGACTGCTATCCTGAGATTAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCT
GCCTTGCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGCGGATCCCCTTTGTCGGCCGCTAT
TTCGTCAAGGAGCCGGTTAACCCTGCGGACAATCCTTTC
Transcript >Ophio5|5821
ATGGAATCTCCCATCAGCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTATCAGCATCAGCCCAACATC
CGCGGATGGAACAGGACTGCTATCCTGAGATTAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCT
GCCTTGCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGCGGATCCCCTTTGTCGGCCGCTAT
TTCGTCAAGGAGCCGGTTAACCCTGCGGACAATCCTTTCTAA
Gene >Ophio5|5821
ATGGAATCTCCCGTATGTCATTTGAAGCTGTCCCCGATCAATCGAAGGCCTACGAACTGAATGCGTCGCAGATCA
GCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTACGTGAGCAACAGCGCCTCCAACACCCCTTCCCCGT
TACTAGCTGCGTCGACTCCCTCAACGCCTCGATCGACCACATTTGAATCACTCGCTTGAGTCCAATGGCTCTGAC
GGCTCGCCTCGCTAGGTATCAGCATCAGCCCAACATCCGCGGATGGAACAGGACTGCTATCCTGAGATTGTGAGT
AGGCTTCTACGTCGTTTGAGCGGAGTCCATACGGATGCTGCAAAACACATATCACGGGCTTGGATAGTTTGGGGG
TGCCACTCGCTAACCTGTCGGCATCAGAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCTGCCTT
GCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGGTGGGTTGTCTGGCCCAAGCGAAGACGGC
CACGCAAGCTGATTCGAGGCGTAGCGGATCCCCTTTGTCGGCCGCTATTTCGTCAAGGAGCCGGTTAACCCTGCG
GACAATGTGAGCTTCACCAGGCTCGAGGTCTGTTTGTTTTTACTGATGAGTAGACAGCCTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail