Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5821
Gene name
Locationscaffold_49:11580..12246
Strand-
Gene length (bp)666
Transcript length (bp)267
Coding sequence length (bp)264
Protein length (aa) 88

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09796 QCR10 Ubiquinol-cytochrome-c reductase complex subunit (QCR10) 1.4E-23 26 88

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:1990204 oxidoreductase complex No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0098798 mitochondrial protein-containing complex No
GO:0045333 cellular respiration No
GO:0022904 respiratory electron transport chain No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009060 aerobic respiration No
GO:0098796 membrane protein complex No
GO:0009987 cellular process No
GO:0019646 aerobic electron transport chain No
GO:0005575 cellular_component No
GO:0098803 respiratory chain complex No
GO:0022900 electron transport chain No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0045275 respiratory chain complex III No
GO:1902495 transmembrane transporter complex No
GO:0070069 cytochrome complex No
GO:1990351 transporter complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5821
MESPISRPPSFKSAYGPKYQHQPNIRGWNRTAILRLGVRAGLYGGAAGVAALLFTSGIPRIRVDIMERIPFVGRY
FVKEPVNPADNPF
Coding >Ophio5|5821
ATGGAATCTCCCATCAGCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTATCAGCATCAGCCCAACATC
CGCGGATGGAACAGGACTGCTATCCTGAGATTAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCT
GCCTTGCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGCGGATCCCCTTTGTCGGCCGCTAT
TTCGTCAAGGAGCCGGTTAACCCTGCGGACAATCCTTTC
Transcript >Ophio5|5821
ATGGAATCTCCCATCAGCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTATCAGCATCAGCCCAACATC
CGCGGATGGAACAGGACTGCTATCCTGAGATTAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCT
GCCTTGCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGCGGATCCCCTTTGTCGGCCGCTAT
TTCGTCAAGGAGCCGGTTAACCCTGCGGACAATCCTTTCTAA
Gene >Ophio5|5821
ATGGAATCTCCCGTATGTCATTTGAAGCTGTCCCCGATCAATCGAAGGCCTACGAACTGAATGCGTCGCAGATCA
GCCGCCCTCCCAGCTTCAAGAGCGCGTACGGGCCAAAGTACGTGAGCAACAGCGCCTCCAACACCCCTTCCCCGT
TACTAGCTGCGTCGACTCCCTCAACGCCTCGATCGACCACATTTGAATCACTCGCTTGAGTCCAATGGCTCTGAC
GGCTCGCCTCGCTAGGTATCAGCATCAGCCCAACATCCGCGGATGGAACAGGACTGCTATCCTGAGATTGTGAGT
AGGCTTCTACGTCGTTTGAGCGGAGTCCATACGGATGCTGCAAAACACATATCACGGGCTTGGATAGTTTGGGGG
TGCCACTCGCTAACCTGTCGGCATCAGAGGCGTCAGAGCTGGTCTGTACGGTGGCGCGGCAGGCGTTGCTGCCTT
GCTCTTCACGTCCGGCATCCCCCGCATTCGCGTCGACATCATGGAGGTGGGTTGTCTGGCCCAAGCGAAGACGGC
CACGCAAGCTGATTCGAGGCGTAGCGGATCCCCTTTGTCGGCCGCTATTTCGTCAAGGAGCCGGTTAACCCTGCG
GACAATGTGAGCTTCACCAGGCTCGAGGTCTGTTTGTTTTTACTGATGAGTAGACAGCCTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail