Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5820
Gene name
Locationscaffold_49:282..10988
Strand+
Gene length (bp)10706
Transcript length (bp)10638
Coding sequence length (bp)10635
Protein length (aa) 3545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.8E-63 63 449
PF00501 AMP-binding AMP-binding enzyme 1.8E-70 1170 1563
PF00501 AMP-binding AMP-binding enzyme 8.0E-69 2933 3335
PF00668 Condensation Condensation domain 1.2E-32 723 1123
PF00668 Condensation Condensation domain 1.2E-22 1792 1960
PF00668 Condensation Condensation domain 2.2E-32 2261 2663
PF00550 PP-binding Phosphopantetheine attachment site 1.7E-04 600 661
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-06 1702 1765
PF00550 PP-binding Phosphopantetheine attachment site 7.1E-14 3475 3536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 33 2672 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 902 2666 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 33 2667 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 32 2581 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 49 2648 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 33 2672 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 902 2666 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 33 2667 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 32 2581 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 49 2648 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 39 1852 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 50 1847 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 50 1847 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 50 1847 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 52 1792 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 25 1852 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1140 2666 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 52 2578 0.0E+00
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 35 1184 2.0E-179
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 52 2578 3.0E-179
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 2578 3.0E-174
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 26 2578 6.0E-169
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 77 2546 4.0E-167
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1103 2207 2.0E-165
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 52 2662 2.0E-165
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 26 2578 3.0E-161
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 45 2248 9.0E-159
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 42 2245 5.0E-148
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 50 2207 2.0E-144
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 50 2246 2.0E-142
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 716 1872 2.0E-140
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2679 3542 5.0E-137
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 26 2245 2.0E-136
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2866 3537 2.0E-135
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 46 2213 3.0E-135
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1111 2005 5.0E-134
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 48 2245 6.0E-133
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2679 3535 1.0E-131
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1682 2639 3.0E-131
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2679 3535 4.0E-131
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 65 2192 7.0E-131
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 53 1771 1.0E-130
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 49 2108 2.0E-129
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2666 3537 1.0E-128
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2688 3535 5.0E-128
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 697 1845 5.0E-128
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 43 2203 1.0E-125
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 721 2546 4.0E-123
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 676 1780 6.0E-120
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 54 1772 8.0E-119
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 77 1977 9.0E-118
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 38 1027 2.0E-117
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1083 2578 2.0E-117
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1088 2798 3.0E-116
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1 1939 7.0E-116
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 721 1951 6.0E-114
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 68 1923 3.0E-113
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 37 2104 6.0E-113
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2678 3541 9.0E-113
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 42 1934 3.0E-112
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2867 3540 1.0E-111
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 26 1764 1.0E-111
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 717 1864 2.0E-111
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 45 1939 4.0E-111
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2622 3535 1.0E-110
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 50 1937 2.0E-110
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 37 2201 3.0E-110
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 45 1939 3.0E-110
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2872 3539 2.0E-109
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 49 1947 3.0E-109
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 26 1764 3.0E-109
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2679 3545 6.0E-109
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 51 1956 1.0E-108
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 52 1978 1.0E-108
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 25 1939 1.0E-107
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2679 3539 2.0E-107
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2669 3537 2.0E-107
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2925 3528 3.0E-107
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 53 1930 4.0E-106
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 53 1930 5.0E-106
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2672 3544 9.0E-106
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 50 1820 1.0E-105
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2922 3528 3.0E-105
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2922 3528 3.0E-105
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 52 1933 3.0E-105
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 52 1954 9.0E-105
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 726 2011 6.0E-104
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 723 1956 2.0E-103
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 52 1049 4.0E-103
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1153 2246 8.0E-103
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2855 3540 9.0E-103
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 35 2168 5.0E-101
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2859 3535 7.0E-101
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 35 2168 7.0E-101
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 39 1025 1.0E-100
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 52 1954 1.0E-100
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 48 1980 2.0E-100
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 56 1968 3.0E-100
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1112 1790 6.0E-100
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 65 1934 7.0E-99
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 52 1934 8.0E-99
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2743 3536 1.0E-98
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2804 3535 6.0E-98
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2922 3537 5.0E-97
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 53 1960 1.0E-96
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 810 2218 2.0E-96
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 718 1978 3.0E-96
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2744 3535 6.0E-96
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1158 1792 7.0E-96
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 75 1938 1.0E-95
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1097 1935 2.0E-95
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 78 1765 8.0E-95
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 717 1954 1.0E-94
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 723 1980 2.0E-94
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 50 1025 2.0E-92
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2677 3542 5.0E-92
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 718 1845 1.0E-91
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 48 1043 2.0E-90
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1164 2246 1.0E-89
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2743 3527 2.0E-89
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 721 1980 2.0E-89
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1164 2246 2.0E-89
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2553 3529 6.0E-89
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 720 1674 1.0E-87
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 724 1930 1.0E-87
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 721 1957 1.0E-87
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 721 1957 2.0E-87
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2690 3535 6.0E-87
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 723 1961 1.0E-85
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2872 3536 6.0E-85
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 719 1937 6.0E-85
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 74 1784 6.0E-85
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 45 1847 7.0E-85
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 724 1763 2.0E-84
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 721 1930 1.0E-83
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 718 1957 7.0E-83
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 34 691 2.0E-82
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 691 1767 2.0E-82
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 32 1048 1.0E-81
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 716 1934 7.0E-81
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 72 1858 8.0E-80
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2679 3529 1.0E-79
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2677 3535 1.0E-77
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 32 1060 5.0E-77
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2924 3542 6.0E-77
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 723 1845 1.0E-76
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2669 3465 2.0E-76
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 32 1060 2.0E-76
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 721 1954 2.0E-76
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 724 1783 9.0E-75
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 721 1964 3.0E-74
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2690 3541 6.0E-74
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2740 3534 1.0E-73
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 18 666 3.0E-72
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 77 1120 7.0E-72
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 713 1759 2.0E-71
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 745 1764 3.0E-71
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 39 673 5.0E-70
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 591 1939 6.0E-70
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 842 2137 7.0E-70
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 36 659 3.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2736 3536 3.0E-69
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2746 3545 3.0E-69
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 491 1864 3.0E-69
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 729 1932 4.0E-69
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2877 3535 8.0E-69
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 721 1765 1.0E-68
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 812 1930 8.0E-68
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2880 3535 9.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 823 1817 1.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2679 3535 3.0E-67
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2746 3537 6.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2679 3535 6.0E-67
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2736 3531 1.0E-66
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2877 3536 8.0E-66
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2744 3545 9.0E-66
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1644 2648 1.0E-65
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2867 3535 2.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2778 3542 8.0E-65
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2679 3535 9.0E-65
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2679 3535 2.0E-64
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2931 3535 2.0E-64
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2679 3542 3.0E-64
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2826 3535 3.0E-64
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2696 3542 4.0E-64
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2794 3509 8.0E-64
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2734 3535 1.0E-63
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 824 1962 1.0E-63
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2794 3509 1.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2822 3535 2.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2860 3536 2.0E-63
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2906 3535 4.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2865 3537 5.0E-63
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2924 3534 1.0E-62
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2679 3539 1.0E-62
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2679 3539 1.0E-62
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 35 651 4.0E-62
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2679 3537 5.0E-62
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2855 3541 6.0E-62
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2863 3543 2.0E-61
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2865 3535 2.0E-61
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2826 3535 2.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2838 3535 3.0E-61
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2740 3535 3.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2850 3535 4.0E-61
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2873 3541 4.0E-61
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2740 3544 7.0E-61
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 43 1764 7.0E-61
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1129 1988 1.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2888 3535 1.0E-60
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2873 3541 2.0E-60
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2858 3535 3.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2855 3535 4.0E-60
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2826 3536 5.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2928 3534 5.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2928 3534 6.0E-60
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2855 3534 1.0E-59
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2927 3537 1.0E-59
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2885 3534 3.0E-59
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 823 1923 5.0E-59
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2913 3536 5.0E-59
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2913 3531 7.0E-59
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 54 1036 9.0E-59
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2857 3536 1.0E-58
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2690 3535 1.0E-58
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1162 1955 1.0E-58
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1164 1763 1.0E-58
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2826 3535 2.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2859 3536 5.0E-58
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2666 3540 1.0E-57
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2720 3531 1.0E-57
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 41 666 2.0E-57
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2746 3537 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2746 3537 3.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2859 3535 3.0E-57
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2931 3536 4.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2746 3537 5.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2860 3535 5.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 723 1638 2.0E-56
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 32 634 4.0E-56
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2696 3537 4.0E-56
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2916 3535 5.0E-56
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2685 3517 6.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2927 3536 8.0E-56
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2842 3535 1.0E-55
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2679 3536 2.0E-55
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2884 3537 4.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2683 3537 7.0E-55
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2690 3535 2.0E-54
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 14 659 5.0E-54
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 38 570 1.0E-53
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2711 3534 1.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 45 863 3.0E-53
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2737 3537 3.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 39 659 5.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2746 3535 5.0E-53
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2674 3535 6.0E-53
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2664 3537 8.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2931 3535 8.0E-53
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2746 3535 8.0E-53
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 76 1169 9.0E-53
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2737 3545 3.0E-52
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2738 3537 5.0E-52
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2926 3535 5.0E-52
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1076 1940 6.0E-52
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1141 1845 1.0E-51
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1076 1940 1.0E-51
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2926 3536 3.0E-51
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 359 1048 8.0E-51
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 42 659 1.0E-50
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2257 2667 2.0E-50
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 823 1764 3.0E-50
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2863 3382 5.0E-50
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2260 2666 1.0E-49
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 16 659 1.0E-49
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2885 3540 6.0E-49
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2817 3535 1.0E-47
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2899 3537 2.0E-47
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1170 1772 2.0E-47
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 53 661 3.0E-47
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 53 661 3.0E-47
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2692 3535 3.0E-47
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1093 1923 4.0E-47
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2817 3535 4.0E-47
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2916 3535 7.0E-47
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 45 672 2.0E-46
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 55 912 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1110 1923 9.0E-46
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 63 1126 9.0E-46
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 41 661 2.0E-45
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2928 3442 5.0E-45
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 50 692 2.0E-44
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2742 3531 2.0E-44
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2928 3442 2.0E-44
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2928 3442 2.0E-44
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2928 3442 3.0E-44
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2928 3442 6.0E-44
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 29 661 7.0E-44
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2928 3442 7.0E-44
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2928 3442 1.0E-43
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 18 661 2.0E-43
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1156 1799 2.0E-43
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1156 1799 2.0E-43
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1156 1799 2.0E-43
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2865 3534 7.0E-43
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 51 665 9.0E-43
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2686 3545 1.0E-42
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 65 692 1.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1163 1672 1.0E-42
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1163 1672 2.0E-42
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1163 1672 2.0E-42
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1163 1672 2.0E-42
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1163 1672 2.0E-42
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1163 1672 3.0E-42
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1163 1672 3.0E-42
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1163 1672 3.0E-42
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1163 1672 3.0E-42
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1163 1672 3.0E-42
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2928 3442 3.0E-42
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2860 3515 3.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2860 3515 4.0E-42
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1163 1672 6.0E-42
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1163 1672 6.0E-42
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2927 3526 6.0E-42
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2927 3526 6.0E-42
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2927 3526 6.0E-42
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1084 1878 6.0E-42
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1163 1672 8.0E-42
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 36 666 1.0E-41
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2927 3545 1.0E-41
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 50 662 1.0E-41
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1163 1670 1.0E-41
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2747 3536 2.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1091 1672 2.0E-41
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2727 3536 3.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2860 3515 3.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 65 662 4.0E-41
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2947 3536 4.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1163 1672 4.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 65 659 5.0E-41
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1163 1672 5.0E-41
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2712 3535 7.0E-41
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2928 3443 7.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 33 989 1.0E-40
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1163 1672 1.0E-40
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 38 1024 2.0E-40
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2927 3543 2.0E-40
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2817 3442 3.0E-40
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2742 3536 5.0E-40
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2928 3442 6.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 40 865 8.0E-40
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2923 3537 8.0E-40
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2951 3542 9.0E-40
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2923 3537 9.0E-40
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1183 1923 1.0E-39
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 39 665 2.0E-39
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 18 1025 2.0E-39
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 842 1624 4.0E-39
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 52 665 4.0E-39
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2932 3534 5.0E-39
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 14 696 8.0E-39
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2928 3534 9.0E-39
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2953 3534 1.0E-38
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 57 661 1.0E-38
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 24 660 1.0E-38
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2932 3444 1.0E-38
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1189 1768 2.0E-38
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1162 1791 2.0E-38
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2862 3534 3.0E-38
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2862 3534 3.0E-38
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2742 3542 3.0E-38
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2860 3535 3.0E-38
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1164 1767 3.0E-38
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1164 1767 3.0E-38
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1120 1763 7.0E-38
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2925 3526 8.0E-38
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1120 1763 9.0E-38
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1120 1763 1.0E-37
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3215 3537 2.0E-37
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 51 659 4.0E-37
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1164 1672 5.0E-37
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1141 1763 2.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2928 3442 3.0E-36
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2932 3444 3.0E-36
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 89 1053 4.0E-36
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1163 1673 6.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1176 1794 6.0E-36
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2932 3444 6.0E-36
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1188 1929 8.0E-36
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2932 3442 2.0E-35
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 33 635 3.0E-35
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 54 691 3.0E-35
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1164 1672 5.0E-35
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1168 1670 7.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1164 1672 8.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1164 1763 9.0E-35
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1162 1784 9.0E-35
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 50 692 2.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1164 1766 2.0E-34
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 48 659 3.0E-34
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2927 3440 6.0E-34
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1172 1672 8.0E-34
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1162 1780 9.0E-34
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2928 3442 1.0E-33
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2932 3444 1.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2932 3442 2.0E-33
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2826 3535 2.0E-33
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2932 3442 2.0E-33
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2932 3444 6.0E-33
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2928 3442 3.0E-32
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2932 3444 4.0E-32
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2928 3442 4.0E-32
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2928 3442 4.0E-32
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1162 1804 5.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2932 3444 5.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2932 3444 8.0E-32
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 39 510 3.0E-31
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 932 1640 4.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1172 1674 5.0E-31
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 26 664 2.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1166 1668 2.0E-30
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2930 3442 3.0E-30
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2930 3442 3.0E-30
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1172 1670 4.0E-30
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1172 1670 4.0E-30
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1172 1670 4.0E-30
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1172 1670 4.0E-30
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1172 1670 4.0E-30
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1172 1670 4.0E-30
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 48 633 5.0E-30
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 48 633 5.0E-30
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 48 633 6.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1209 1674 8.0E-30
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1172 1670 9.0E-30
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1474 1776 1.0E-29
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2930 3394 1.0E-29
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1172 1672 1.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2930 3442 1.0E-29
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2928 3445 1.0E-29
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1166 1670 1.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1166 1668 1.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2930 3442 1.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1166 1668 1.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2930 3442 1.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1166 1668 1.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2930 3442 1.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1166 1668 1.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2930 3442 1.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2932 3442 1.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1172 1670 1.0E-29
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2951 3518 2.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2930 3442 2.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2930 3442 2.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2930 3442 2.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2930 3442 2.0E-29
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2920 3544 3.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1166 1672 3.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2930 3442 3.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2930 3442 3.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2930 3442 3.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2930 3442 3.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2930 3442 3.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1166 1672 4.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1166 1672 4.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1166 1672 4.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1166 1672 5.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2928 3445 5.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1166 1668 6.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1166 1668 6.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2930 3442 6.0E-29
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1166 1670 6.0E-29
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 42 639 7.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1189 1668 7.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1166 1672 7.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1166 1672 7.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1166 1672 7.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1166 1672 7.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1166 1672 7.0E-29
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2932 3442 7.0E-29
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1172 1674 9.0E-29
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1172 1674 1.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1168 1672 1.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1186 1674 2.0E-28
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 42 639 3.0E-28
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 52 639 3.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1186 1674 3.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1186 1674 3.0E-28
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1168 1672 3.0E-28
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 42 639 5.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2930 3442 5.0E-28
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2951 3522 8.0E-28
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1172 1674 1.0E-27
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1164 1670 3.0E-27
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 53 568 4.0E-27
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2946 3536 5.0E-27
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2932 3442 7.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1230 1577 1.0E-26
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2914 3545 2.0E-26
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 57 568 3.0E-26
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2936 3445 3.0E-26
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 57 569 4.0E-26
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2936 3445 5.0E-26
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2936 3445 1.0E-25
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2936 3445 1.0E-25
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2901 3382 2.0E-25
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 56 570 4.0E-25
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 6 660 1.0E-24
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 57 568 1.0E-24
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1150 1804 1.0E-24
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 57 570 2.0E-24
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1163 1674 2.0E-24
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 57 570 3.0E-24
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 57 570 4.0E-24
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 57 570 4.0E-24
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 57 570 4.0E-24
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2995 3355 4.0E-24
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 57 570 5.0E-24
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 57 568 5.0E-24
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 45 659 8.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 594 1025 1.0E-23
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 57 570 1.0E-23
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 78 570 1.0E-23
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 47 659 3.0E-23
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 47 659 3.0E-23
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1213 1737 3.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1188 1670 1.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 57 568 2.0E-22
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 57 570 3.0E-22
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 57 565 3.0E-22
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 78 570 3.0E-22
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1187 1739 3.0E-22
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 78 570 5.0E-22
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 78 570 5.0E-22
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 69 661 1.0E-21
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 3 589 2.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 725 1044 4.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 503 990 1.0E-20
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 57 568 2.0E-20
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 78 568 2.0E-20
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 78 568 2.0E-20
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 78 568 2.0E-20
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 78 659 3.0E-20
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 78 568 3.0E-20
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 78 568 3.0E-20
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 78 568 4.0E-20
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 78 568 4.0E-20
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 78 568 4.0E-20
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 78 568 4.0E-20
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 78 568 4.0E-20
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 76 583 7.0E-20
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 78 564 8.0E-20
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 51 660 2.0E-19
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 77 681 2.0E-19
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 77 568 2.0E-19
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 77 570 2.0E-19
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 57 633 2.0E-19
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 77 570 3.0E-19
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 56 565 3.0E-19
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 583 1052 4.0E-19
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 65 565 5.0E-19
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2928 3442 5.0E-19
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 77 570 9.0E-19
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 77 570 9.0E-19
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 65 565 1.0E-18
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 77 570 1.0E-18
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 65 565 1.0E-18
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 56 565 1.0E-18
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 65 565 2.0E-18
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2978 3527 2.0E-18
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 57 564 3.0E-18
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 57 564 3.0E-18
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2928 3345 3.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3398 3542 4.0E-18
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 57 564 4.0E-18
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 57 564 4.0E-18
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 57 564 4.0E-18
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 57 564 4.0E-18
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 57 564 4.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 723 1075 9.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2682 2921 1.0E-17
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1220 1631 1.0E-17
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1310 1748 1.0E-17
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1299 1674 1.0E-17
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 51 660 3.0E-17
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2259 2641 4.0E-17
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 72 565 4.0E-17
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 65 565 6.0E-17
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 65 565 6.0E-17
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 65 565 6.0E-17
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 65 565 6.0E-17
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 65 565 6.0E-17
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 65 565 6.0E-17
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1211 1631 8.0E-17
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 201 569 1.0E-16
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1164 1737 3.0E-16
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2258 2643 4.0E-16
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1211 1631 8.0E-16
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 33 466 1.0E-15
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1311 1681 1.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1211 1673 2.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 3077 3520 2.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1308 1740 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2259 2643 3.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2266 2619 3.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2945 3452 3.0E-15
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 65 571 3.0E-15
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2945 3349 4.0E-15
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1168 1673 4.0E-15
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1188 1631 4.0E-15
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1187 1631 5.0E-15
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1305 1672 1.0E-14
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2952 3443 1.0E-14
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1170 1675 1.0E-14
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2254 2578 2.0E-14
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 76 645 2.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 3077 3540 2.0E-14
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1164 1683 2.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2260 2662 3.0E-14
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1168 1672 3.0E-14
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2951 3445 3.0E-14
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 78 569 5.0E-14
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1304 1668 6.0E-14
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1304 1668 7.0E-14
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1304 1668 7.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1168 1673 7.0E-14
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1304 1668 7.0E-14
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1308 1675 7.0E-14
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 531 1144 8.0E-14
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1311 1668 8.0E-14
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1304 1668 8.0E-14
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1311 1668 8.0E-14
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1304 1668 8.0E-14
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1304 1668 9.0E-14
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 1303 1705 9.0E-14
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1304 1668 9.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2219 2596 1.0E-13
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 61 660 1.0E-13
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1168 1673 1.0E-13
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1304 1668 1.0E-13
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1304 1668 1.0E-13
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1304 1668 1.0E-13
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1304 1668 1.0E-13
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 1160 1678 1.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2258 2601 2.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2928 3509 2.0E-13
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2257 2562 4.0E-13
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 3078 3346 4.0E-13
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2945 3345 4.0E-13
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2258 2588 5.0E-13
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2930 3443 5.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2934 3367 6.0E-13
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2928 3448 6.0E-13
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 201 569 6.0E-13
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 65 565 1.0E-12
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 77 565 1.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 1164 1675 1.0E-12
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1304 1675 1.0E-12
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1311 1674 1.0E-12
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1304 1675 1.0E-12
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1311 1675 1.0E-12
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1170 1676 1.0E-12
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2254 2571 2.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 586 1025 2.0E-12
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 57 568 2.0E-12
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1291 1678 2.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2928 3444 2.0E-12
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2951 3443 2.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1305 1668 2.0E-12
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1311 1668 2.0E-12
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 1164 1669 2.0E-12
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 1164 1669 2.0E-12
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1311 1668 2.0E-12
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2253 2654 3.0E-12
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 103 653 3.0E-12
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1311 1668 3.0E-12
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 1302 1676 3.0E-12
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 1302 1676 3.0E-12
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1311 1668 3.0E-12
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1311 1668 3.0E-12
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 53 569 3.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2951 3345 4.0E-12
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1300 1679 4.0E-12
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2928 3345 4.0E-12
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2253 2654 5.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 44 466 5.0E-12
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 65 568 5.0E-12
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 1293 1672 5.0E-12
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1311 1668 5.0E-12
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 1302 1676 5.0E-12
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1166 1673 6.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2258 2578 7.0E-12
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 75 570 7.0E-12
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 1187 1673 8.0E-12
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2257 2562 1.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2251 2641 1.0E-11
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2301 2641 1.0E-11
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2244 2542 1.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2255 2580 1.0E-11
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2255 2580 1.0E-11
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2306 2596 1.0E-11
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 50 473 1.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1164 1679 1.0E-11
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 3072 3440 1.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 193 469 1.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2945 3345 1.0E-11
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1224 1679 1.0E-11
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1309 1674 1.0E-11
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2928 3443 1.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2258 2626 2.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3074 3543 2.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 193 469 2.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2932 3443 2.0E-11
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1303 1675 2.0E-11
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1166 1673 2.0E-11
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2930 3363 2.0E-11
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2930 3363 2.0E-11
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1146 1673 2.0E-11
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2928 3444 2.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2256 2578 3.0E-11
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2951 3444 3.0E-11
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1304 1675 3.0E-11
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2247 2569 4.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2951 3355 4.0E-11
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1232 1631 4.0E-11
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 1188 1705 4.0E-11
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1161 1673 4.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1303 1631 4.0E-11
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 1165 1690 4.0E-11
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2255 2662 5.0E-11
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2932 3442 5.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 71 478 5.0E-11
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2230 2537 6.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 76 633 6.0E-11
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 183 568 6.0E-11
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2928 3443 6.0E-11
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1286 1630 6.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2258 2546 8.0E-11
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 1304 1668 8.0E-11
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1308 1673 8.0E-11
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2985 3350 9.0E-11
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 532 890 1.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2927 3345 1.0E-10
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1311 1673 1.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2945 3349 1.0E-10
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1306 1630 1.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2971 3347 2.0E-10
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 65 571 2.0E-10
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 73 571 2.0E-10
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 2948 3447 2.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 3078 3443 2.0E-10
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 1303 1673 2.0E-10
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2304 2580 3.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 63 565 3.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 63 565 3.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1180 1687 3.0E-10
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1170 1675 3.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2934 3445 3.0E-10
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1311 1673 3.0E-10
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1304 1678 3.0E-10
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 1311 1673 3.0E-10
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 185 566 3.0E-10
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2903 3345 3.0E-10
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1170 1673 3.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 69 569 4.0E-10
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2932 3445 4.0E-10
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2932 3445 4.0E-10
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2932 3445 4.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2260 2580 5.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1180 1687 5.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1187 1672 5.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1311 1673 5.0E-10
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2932 3445 5.0E-10
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2928 3443 6.0E-10
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1170 1675 6.0E-10
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1170 1675 6.0E-10
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1170 1625 6.0E-10
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1303 1631 6.0E-10
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 1304 1673 6.0E-10
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 1311 1630 6.0E-10
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2932 3445 6.0E-10
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 2928 3345 6.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1300 1669 6.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 77 469 7.0E-10
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1300 1669 8.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2260 2579 1.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 76 469 1.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1164 1631 1.0E-09
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 69 569 1.0E-09
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 55 565 1.0E-09
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 3029 3445 1.0E-09
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1302 1631 1.0E-09
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 3074 3453 1.0E-09
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 3055 3443 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2306 2668 2.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2258 2783 2.0E-09
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3396 3544 2.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 191 570 2.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2973 3349 2.0E-09
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 3071 3445 2.0E-09
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 3071 3445 2.0E-09
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2952 3453 2.0E-09
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2928 3350 2.0E-09
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 3075 3445 2.0E-09
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1170 1675 2.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2945 3452 2.0E-09
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 1170 1666 2.0E-09
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 197 571 2.0E-09
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2932 3445 2.0E-09
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 57 572 2.0E-09
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2934 3445 2.0E-09
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2251 2584 3.0E-09
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 1309 1675 3.0E-09
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1697 2146 3.0E-09
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1697 2146 3.0E-09
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1146 1673 3.0E-09
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1146 1673 3.0E-09
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1311 1674 3.0E-09
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2981 3443 3.0E-09
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 3072 3444 4.0E-09
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 3072 3444 4.0E-09
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 3072 3444 4.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1297 1631 4.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1182 1631 4.0E-09
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1697 2146 4.0E-09
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1292 1631 4.0E-09
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 3048 3524 4.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 197 466 5.0E-09
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 3072 3444 5.0E-09
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 3072 3444 5.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 71 500 5.0E-09
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1304 1675 5.0E-09
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 1311 1673 5.0E-09
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 3072 3444 6.0E-09
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 3072 3444 6.0E-09
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 3072 3444 6.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 81 574 6.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2934 3345 6.0E-09
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2947 3444 6.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1233 1631 6.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2934 3443 6.0E-09
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 1311 1675 6.0E-09
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 1311 1675 6.0E-09
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 1229 1673 6.0E-09
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2896 3443 6.0E-09
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 3072 3444 7.0E-09
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 3072 3444 7.0E-09
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 3072 3444 7.0E-09
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 3072 3444 7.0E-09
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 3072 3444 7.0E-09
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1311 1675 7.0E-09
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 1166 1675 7.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1222 1631 7.0E-09
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 1311 1675 7.0E-09
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 1311 1675 7.0E-09
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2953 3443 7.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1199 1631 8.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2932 3443 8.0E-09
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 3075 3445 8.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 3072 3449 8.0E-09
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 1309 1675 8.0E-09
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 45 469 9.0E-09
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1304 1675 9.0E-09
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 1211 1631 9.0E-09
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2251 2629 1.0E-08
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2250 2589 1.0E-08
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 3071 3444 1.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 3071 3444 1.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 3071 3444 1.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 3072 3444 1.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 3072 3444 1.0E-08
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 3070 3443 1.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1311 1673 1.0E-08
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 3055 3443 1.0E-08
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2904 3444 1.0E-08
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 1311 1675 1.0E-08
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 1311 1675 1.0E-08
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 1311 1675 1.0E-08
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 1311 1675 1.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1146 1673 1.0E-08
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 3074 3453 1.0E-08
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 1278 1673 1.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2443 2649 2.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 3071 3444 2.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 3071 3444 2.0E-08
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1160 1673 2.0E-08
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 3072 3445 2.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 3074 3450 2.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1292 1631 2.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 90 584 2.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2932 3443 2.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1146 1673 2.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1146 1673 2.0E-08
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 2920 3358 2.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2372 2548 3.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2928 3443 3.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 3072 3444 3.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 3072 3444 3.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 3072 3444 3.0E-08
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2930 3445 3.0E-08
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 193 571 3.0E-08
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 3055 3443 3.0E-08
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 3055 3443 3.0E-08
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1304 1675 3.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2256 2578 4.0E-08
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 189 466 4.0E-08
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 1303 1680 4.0E-08
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1303 1673 4.0E-08
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 3029 3443 4.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2210 2541 5.0E-08
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 1309 1675 5.0E-08
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2247 2584 6.0E-08
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 3072 3444 6.0E-08
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 2951 3458 6.0E-08
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 3071 3445 6.0E-08
sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 2920 3358 6.0E-08
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 3072 3445 7.0E-08
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2931 3349 7.0E-08
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2931 3349 7.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 329 470 8.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 3071 3444 8.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 3070 3443 8.0E-08
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 1303 1675 8.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 62 571 9.0E-08
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 1188 1673 9.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3472 3534 1.0E-07
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2296 2546 1.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 200 466 1.0E-07
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 3071 3444 1.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 198 571 1.0E-07
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2927 3444 1.0E-07
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 3072 3443 1.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 3072 3446 1.0E-07
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1170 1613 1.0E-07
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2927 3444 1.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 3062 3399 1.0E-07
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2896 3443 1.0E-07
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 1308 1622 1.0E-07
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2953 3395 1.0E-07
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 1309 1675 1.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1311 1673 1.0E-07
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 3074 3443 1.0E-07
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2252 2642 2.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3400 3537 2.0E-07
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 596 1023 2.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 3075 3350 2.0E-07
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 3074 3443 2.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 3071 3443 2.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2947 3350 2.0E-07
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1222 1631 2.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 1292 1669 2.0E-07
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 3012 3453 2.0E-07
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 1292 1678 2.0E-07
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 1309 1706 2.0E-07
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 1280 1673 2.0E-07
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 1280 1673 2.0E-07
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 1311 1673 2.0E-07
sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 2920 3446 2.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2934 3445 3.0E-07
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 193 570 3.0E-07
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 1168 1674 3.0E-07
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 3029 3443 3.0E-07
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1291 1631 3.0E-07
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 1280 1673 3.0E-07
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2255 2599 4.0E-07
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2269 2577 4.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 196 569 4.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 2972 3349 4.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2306 2641 5.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3400 3537 5.0E-07
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 76 571 5.0E-07
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 78 570 5.0E-07
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 198 571 5.0E-07
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 197 571 5.0E-07
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 1311 1673 5.0E-07
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 1311 1673 5.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 3076 3443 5.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 199 569 5.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1309 1673 5.0E-07
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 3032 3457 5.0E-07
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 3032 3457 5.0E-07
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 3074 3438 6.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2953 3443 6.0E-07
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 201 569 6.0E-07
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 3032 3457 6.0E-07
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1308 1673 6.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 3072 3445 7.0E-07
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 1311 1669 7.0E-07
sp|P19409|BAIB_CLOSV Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 1175 1670 7.0E-07
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1309 1678 7.0E-07
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 200 569 7.0E-07
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 200 569 7.0E-07
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 200 569 7.0E-07
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 2951 3458 8.0E-07
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 1303 1680 8.0E-07
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 1303 1680 8.0E-07
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 1303 1675 8.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 1305 1580 9.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1306 1673 9.0E-07
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 1311 1673 9.0E-07
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 1187 1673 9.0E-07
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 1187 1673 9.0E-07
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1314 1624 9.0E-07
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 1187 1673 9.0E-07
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 715 1040 1.0E-06
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2306 2536 1.0E-06
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1640 1843 1.0E-06
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 71 469 1.0E-06
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 69 577 1.0E-06
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 1301 1673 1.0E-06
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 3070 3443 1.0E-06
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 201 569 1.0E-06
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 1311 1673 1.0E-06
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 1311 1673 1.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1291 1631 1.0E-06
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 1303 1678 1.0E-06
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 1280 1673 1.0E-06
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 193 569 1.0E-06
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 1280 1673 1.0E-06
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 1280 1673 1.0E-06
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 76 414 1.0E-06
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 1311 1673 1.0E-06
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 182 466 2.0E-06
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 1311 1673 2.0E-06
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 1309 1678 2.0E-06
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1306 1673 2.0E-06
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 1309 1677 3.0E-06
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 1311 1673 3.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2253 2670 4.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 65 569 4.0E-06
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 1311 1673 4.0E-06
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 192 471 4.0E-06
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 1311 1673 4.0E-06
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1306 1673 4.0E-06
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 1311 1673 4.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1166 1578 4.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1166 1578 4.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 3075 3445 5.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 1155 1676 6.0E-06
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 2932 3359 6.0E-06
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 1311 1673 6.0E-06
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 1311 1673 6.0E-06
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 1311 1673 6.0E-06
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 1311 1673 6.0E-06
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 201 573 6.0E-06
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 171 633 7.0E-06
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 1311 1673 7.0E-06
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 1311 1673 7.0E-06
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 3076 3457 7.0E-06
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 200 633 9.0E-06
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 201 569 1.0E-05
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 1207 1631 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5820
MRYHIDPVCNGNGVWHANRSTTRKEVAKETLPRALDDIWTRNAVVPESVEACVHGLIKRIVCEQPSAPAVCSWDG
NLSYGELDKLSSNLARQLVQLGVGPATMVLLSFEKSVLMPIAALAVMKAGGASVALDVTQPEDHLRILASRVSAP
FILSSAANESLARQLGGHVLVVDREQLAGPPTKQLQHELFPLVTPSDVLYVVFTSGCTGAPKGAVITHRNFSSAI
AYQQKALGFTSSSRVYDYASYASHVAWYNLVHALTCGGCLCIPSEADRRSNVSASIAELGANYAQLPPSVARALH
LSQLPALRQLNLVGEPSSPLEAEELGRADIATVSAYGLSETASLAVVWAANGAESVHQPPAGVCAWVVDSEDPRS
LAPFGAEGELWLEGPLVGPGYLNDPDRTAAAFVQDPEWLLRGTPKWPGRRGRTHRTGDLVRYDDNGQLVFVGRRE
QPRVGGGKRVDPSAIEHHLRQAALPLIDNNEDDFDGLQLIAETIQPQGAESAVLVAFVALDGARDMPDERYGEAA
HRVAARLSEGLSAALPPHMVPEAFIPIQAVPMTATGKIDRHCLRSIGSLLTEPEMARLRGAGRPAPRSEAERLMA
ELWAQALQTELSSLGRDDDFFASGGDATAALRLSRLARERKLPLEAREVFRTPRLRDMAAWAATQTPWAATQKSS
PLAATEMISSPLAAFPPPLSLLERPVDEAEIRAQAARLCRVSDALVLDVLPCTPLQAGLLALTAQQAGAYVAHNV
FELGPDVDVNRFRASWDQVVALNPILRTRIVSLPRHGVVQVVLEEGAHWYSGSGCADDYRLDKASRTMGLGTPLS
RFALFEDGGPRQFVWEVHHALYDGWSLPLLMQEAEHVYYGEFSPPLEPMTNLIKYISERDEATTKAFWQAQFTGI
KGAHFPAPRSAAPYEPRPDSQMTRAVSGLEWGRGDVTPASVIRAAWAIMVAHSADSDEALFGLTVTGRQAAVPGI
ERMAGPAIATVPVRVVVDWDDSVSRLLGAVQRQAADMIPYEQTGLQRIRRVSEAAAVACSFQSLLVIQPGGGGDA
DSSDTAGRVFLTEPAVDHHATTQWQDFSTYAVVVECQLDSDEVRLRIGFDSTVVGRQQMDRIARGFESVLRLLCA
EKRAKDRLRAAVVPSLSQASIDDIWRWNATVPAAVEGRIHDLVSQRARERPQAPAVCAWDGELTYGQLDDLSTKL
ALNLVARGVTGTIVPLFFEKSMWMPVAALAVMKAGGASIAMETTQPEERLRGIAAQADSPVVLASVQKSALARGL
VSAEVMTVGPNQPAPDADSKEVASLPVVDPSSILYIVFTSGSTGTPKGAIVTHSNFASAAAYQQLPLGYDANSRV
FDFASYAFDASWYNLLNALTVGGCLCIPSAEERENNLSGSIEKYKVTTADLTPSVARFLGPETLSHLSTLILGGE
AVLPSDALLAGDKTKIINVYGPAECTPTITLAPVVKEDKDGVTIGRGAGVCTWVVHPEDDSCLAPIGAVGELWVE
GPLVGRGYLNDAEKTAAAFVQDPVWLTQGGRSGRVYRTGDLVRYREDGSLLFVGRKDTQVKIRGQRIELGEVEHH
VLRALEPVEGVDVSNAQVVAETIKPDEAKGAILVAFIVLESAASTSEKDHAAAVAKLTHGLADRLALTLPGFMIP
SAFIPAHGIPMSGTGKTDRRLLQTMGAASWLRHRAAADKVEPATDLTELEKLLQQIWISVLLLLPEEASVNKLFT
RLGGDSISAMQVVSQCRLHGLSLTASDVLQAGTIRKLAQRCQTVTGQQPIAESSSEDETAGNEPFDLTPIQQMFF
EAYPDGLDHYNQSFILDLGQPASIKTLRAAMRALVSRHEMLRARYFKDVSAGDRWRQRILDEDDDTAYAFTHQAV
ARRDDMAEAAQRRQETLDIRTGPVFACDVFDVAGEQSLVLSAHHLVIDLVSWRIIWADIEDFVRQGSMRSQRTAS
FRAWCRRQARVGSGLSPLDVLPFPVPAPELGFWALPARENTFGDCVNLTETIGRETSTLVLGDANDSLRTEPVDL
LVASVVHSFVRAFPERPPPVVWLEGHGREQSAELPYDVSETVGWFTTMYPVPVPAAAAGGSLLEAVRTAKDTRRK
VPGKGQPYFACRYHSVAGREAFAGHDVAEITLNFTGRYQQLESEESLFGRAEQPAEAERSITEVSESAPRTAMIE
INAGVEDGRLGVSFCFHRRMRHQDRLRRWAENGFGAALSSLARELRQAPSAPTLTDLPLLPLSYHGLDELLLRQL
PAMGIRPENVTDMYPCSPLQEGILLSAFKGAATYDTFSVYRCAPNVAGSSVSPARLEAAWRRVVARHSILSTVFT
LHPEGGGFVQIVVPESPVRVAHTTSSGSSPVAALSLIERPVFGPGDPRVAFTVCRSDAGDIAVRLDLSHALIDAY
SMSILVQELVAAYDDCEMPSAPSFIDMVRFIDSTPKAQRLASWTALLEGVEPCVVPVTEPSPGLDVDEGHGDVSL
PTNLASAITGFCREMGITRSVFLQVAWSMALSHFTGMQEACFGYLASGRDAPVDKIETMVGPLANLLIGRIDLRR
PARQVLEKALQHSIEHLSMQHASLAEIQHHLGISGRRLFNTSLSIREADKLKATDNRTITLDSDVGEDPHEYDLS
LSANIDGAKMDIVMEYREPYISKGVAREACITLEKAIDYLLSVGADEENLEPLFDGFFKRVVGADQDSASAFWKA
QFAGIQGSNFPPVKSGASHAELDGRVQLDISGLNWDRADCTALVRAAWSMVTARSMGSDEISFGAVVGSQDAPAV
VPVRVQLDWEAGTEKLLGDIRSQAAVMATYQHTGLARIRCMSDEAALACDFKTLLVIRSAEEQVESNRDGSHAML
VEVETRNADDARVCITFDSHSISEARVSRVTHQFQHVLRQLAGPAKARLRDITVVSQRDLDDIWTWNATVPALVE
GCLHDLIEQRAREQPLAPAIDAWDGSLTYGQLSELSTRLAHQLVGQGVQQGCVVPLVFEKSMWMPVAALAVMKAG
GASVAVDSTQPEERIRVIATQARSAGRLVVVCSIANEALVRRLEPDALVSIGLDRLPESLPERYPVLPTVSPTDV
LYIVFTSGSTGRPKGAIVSHQNFYSAVVYQRDDLGYRSNSRVFDFASYAFDIAWSNLLNTLTAGACLCIPSAAER
ENNLPGSLEKYRVTVADLTPSVARFIEPKSSLSNLSTLLLGGEVVLPSDALIVPDHTLVVSAYGPAECTPTSTIL
HLKSSSEMGIGRAAGLCTWVVDMDNPEALAPIGAIGELWLEGPLVGLGYLDEPEKTAAAFIQDPEWLVRGAPGTR
EGRRGSVYRTGDLVQYKEDGTLLFVGRKDTQVKIRGQRVELGEVEHHVLRAIKAAEPAASFQIIAETIQPKGADS
KTLVAFVALDGAKDMTPDEYDDKVRQATAGLNDRLAETLPVFMLPTAYVPLQTVPMMATGKADRRQLRAIGSSLS
TRDIARLSRVEGDRRPPRTDSERTMQALWAEVLKVDPESIGIDDSFFRIGGDSIGAMRLVGIARQQGLGLSVRDI
FQNPVLRDLAAVENHSSVPS
Coding >Ophio5|5820
ATGAGATACCACATCGACCCAGTCTGCAACGGAAACGGAGTCTGGCACGCCAACCGCTCGACGACGCGCAAAGAG
GTCGCCAAGGAGACGCTCCCACGAGCCCTAGACGACATCTGGACTCGTAATGCCGTCGTTCCCGAGTCCGTCGAG
GCTTGCGTTCACGGCCTCATCAAAAGAATTGTCTGTGAGCAGCCGTCTGCACCGGCCGTCTGCTCGTGGGATGGC
AATCTAAGCTACGGCGAGCTCGACAAGCTCTCGAGCAATCTCGCCCGACAACTGGTTCAATTGGGAGTCGGCCCG
GCCACCATGGTTCTCTTGAGCTTCGAAAAGTCGGTTCTAATGCCCATTGCCGCGCTGGCCGTCATGAAGGCCGGC
GGCGCTTCCGTCGCCCTCGACGTCACCCAGCCAGAGGACCATCTGCGCATCCTCGCCTCACGGGTGTCCGCCCCC
TTCATCCTCTCCTCAGCCGCCAACGAGTCTCTGGCCAGACAACTCGGCGGCCATGTCTTAGTCGTCGACCGAGAG
CAGCTCGCCGGCCCGCCAACCAAGCAGCTCCAGCATGAACTATTTCCTCTCGTCACTCCGTCCGACGTCCTCTAC
GTCGTCTTCACCTCGGGCTGTACCGGTGCTCCTAAGGGGGCCGTCATCACGCACCGCAACTTTAGCAGCGCCATC
GCGTACCAGCAAAAGGCCCTAGGCTTCACCAGCAGCTCCCGCGTGTACGACTATGCTTCTTACGCTTCCCACGTG
GCGTGGTACAACCTTGTGCACGCACTGACGTGTGGTGGCTGTCTCTGCATCCCATCTGAGGCTGACCGGCGGTCT
AACGTGTCGGCATCTATTGCCGAGCTGGGCGCCAACTACGCCCAGTTGCCACCCTCGGTAGCACGGGCTCTTCAT
CTGTCCCAGCTTCCGGCTCTGCGGCAATTGAATCTTGTAGGCGAGCCCTCGAGCCCTCTCGAGGCCGAAGAGCTG
GGTCGGGCCGACATAGCCACCGTCAGCGCTTATGGTCTCTCCGAGACAGCGTCTCTGGCCGTAGTGTGGGCGGCC
AATGGTGCCGAGTCTGTACATCAGCCGCCGGCCGGCGTGTGCGCATGGGTTGTCGACTCGGAAGATCCGCGATCC
CTAGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTAGAAGGGCCGCTGGTCGGTCCGGGGTACCTCAATGATCCA
GACCGGACCGCCGCCGCCTTTGTCCAAGACCCGGAATGGCTTCTCCGCGGCACACCCAAATGGCCCGGGCGCCGA
GGGCGAACCCATCGCACAGGCGATTTGGTCCGCTACGACGACAATGGCCAGCTTGTCTTCGTCGGTCGTCGAGAG
CAGCCTCGCGTCGGCGGAGGCAAACGAGTTGACCCCAGCGCTATCGAGCACCATTTACGCCAGGCTGCCCTGCCG
CTCATCGACAATAACGAAGACGACTTTGACGGCCTGCAACTCATCGCCGAGACGATTCAGCCGCAGGGAGCCGAA
TCTGCTGTTCTTGTCGCCTTCGTCGCCCTCGATGGAGCCAGAGACATGCCAGATGAAAGGTACGGCGAAGCGGCG
CACCGGGTGGCAGCCCGTCTATCCGAGGGCCTATCCGCTGCTCTGCCGCCTCACATGGTTCCCGAGGCCTTCATC
CCGATCCAGGCCGTACCTATGACAGCAACTGGCAAAATCGACCGCCACTGTCTGCGCTCCATCGGCTCGCTCCTC
ACCGAGCCGGAGATGGCACGCCTCCGAGGTGCCGGCCGGCCTGCGCCGCGCTCCGAAGCCGAGAGGCTCATGGCC
GAGCTGTGGGCTCAAGCGCTACAGACGGAGCTTTCATCCCTCGGCCGAGACGACGACTTCTTCGCCTCGGGCGGC
GACGCTACTGCCGCCTTGCGTCTCTCCCGCCTCGCTCGCGAGCGGAAGCTCCCGCTAGAGGCACGCGAAGTCTTT
CGGACGCCCCGGTTACGCGACATGGCGGCCTGGGCGGCCACGCAAACCCCCTGGGCGGCCACGCAGAAGTCTTCC
CCCTTGGCGGCCACGGAAATGATATCCTCCCCCTTGGCAGCCTTCCCGCCTCCCCTGTCGCTGCTGGAGCGCCCC
GTGGACGAGGCCGAGATCCGGGCCCAGGCGGCGCGCCTTTGCCGCGTGTCAGATGCCTTGGTTCTCGATGTTCTG
CCTTGTACGCCCCTGCAGGCTGGCCTCCTTGCCTTGACGGCACAGCAAGCCGGCGCCTACGTGGCTCACAACGTC
TTCGAGCTGGGCCCGGACGTTGACGTGAACCGGTTCCGCGCCAGCTGGGACCAGGTAGTGGCCCTTAACCCGATC
CTGCGGACGCGCATCGTCAGTTTGCCGCGTCACGGCGTTGTCCAGGTCGTGCTGGAGGAGGGAGCTCACTGGTAC
TCCGGCTCTGGCTGCGCCGACGACTACCGCCTCGACAAGGCCTCCCGCACCATGGGCCTTGGGACCCCTCTTTCT
CGCTTTGCCCTGTTTGAGGACGGCGGCCCGCGGCAGTTTGTGTGGGAGGTTCATCACGCCCTATACGACGGCTGG
TCGCTGCCGCTGCTGATGCAGGAAGCTGAGCACGTCTACTACGGCGAGTTCAGCCCGCCCTTGGAGCCCATGACC
AACCTCATCAAGTACATCTCAGAGCGCGACGAAGCGACTACAAAGGCCTTCTGGCAGGCTCAATTTACCGGAATC
AAGGGGGCCCACTTCCCGGCCCCGAGGTCAGCCGCGCCGTACGAGCCCCGCCCCGATTCGCAGATGACCCGGGCC
GTGTCCGGTCTGGAGTGGGGCCGAGGCGACGTCACCCCGGCCTCCGTCATCCGGGCCGCCTGGGCAATCATGGTC
GCCCATAGCGCCGATTCGGATGAGGCTCTGTTTGGACTGACCGTGACGGGCCGACAGGCGGCGGTGCCCGGCATT
GAGCGCATGGCTGGACCGGCCATCGCCACCGTCCCAGTGCGCGTAGTTGTCGACTGGGACGACAGCGTGAGCCGC
CTGCTGGGAGCCGTCCAGCGCCAGGCAGCCGACATGATCCCTTACGAGCAGACGGGTCTGCAGAGGATCCGCCGC
GTAAGCGAGGCCGCCGCCGTTGCCTGTAGCTTCCAGTCGCTCCTCGTCATCCAGCCCGGCGGAGGAGGTGATGCA
GACAGTTCGGACACGGCCGGCCGCGTCTTCTTGACGGAACCAGCCGTCGACCACCACGCGACGACGCAGTGGCAA
GACTTTAGCACCTATGCTGTCGTCGTCGAATGCCAGCTCGACTCCGACGAGGTCCGACTTCGCATCGGCTTCGAC
TCGACCGTCGTCGGCCGCCAGCAGATGGATCGAATTGCCCGCGGCTTCGAGAGTGTTTTGCGCCTGCTGTGCGCT
GAGAAACGCGCCAAGGACAGGCTCCGGGCCGCCGTCGTGCCCAGCCTCTCCCAGGCGTCCATCGACGATATCTGG
CGCTGGAACGCCACCGTCCCGGCCGCCGTCGAGGGCCGCATCCACGACCTGGTGTCCCAGAGGGCTCGGGAACGA
CCTCAGGCGCCGGCCGTATGCGCCTGGGACGGAGAGCTCACGTATGGACAACTAGACGATCTCTCCACCAAACTT
GCTCTTAACCTAGTGGCCCGAGGCGTGACCGGCACCATTGTCCCACTCTTTTTCGAAAAGTCCATGTGGATGCCG
GTAGCCGCTCTCGCCGTAATGAAGGCCGGCGGCGCATCTATCGCCATGGAAACGACGCAACCCGAGGAGAGGCTT
CGGGGCATCGCCGCCCAGGCCGATTCGCCCGTTGTGCTGGCTTCGGTGCAAAAGAGCGCCCTGGCCCGAGGCTTG
GTCTCCGCAGAGGTCATGACCGTCGGACCCAACCAGCCGGCTCCGGACGCCGACTCCAAGGAGGTGGCGTCATTG
CCCGTCGTCGACCCGTCAAGCATCCTATACATTGTCTTCACATCCGGCAGCACGGGAACGCCTAAGGGCGCCATC
GTGACCCATAGTAACTTTGCCAGCGCCGCCGCCTATCAGCAGCTGCCGCTAGGCTACGACGCCAACTCGCGCGTA
TTCGACTTCGCGTCTTACGCCTTTGACGCTTCGTGGTATAACCTTCTCAACGCCCTAACCGTCGGCGGCTGTCTC
TGTATCCCCTCTGCCGAGGAGCGCGAAAACAACCTCAGCGGCTCTATAGAGAAGTACAAGGTTACGACGGCGGAC
CTGACGCCTTCAGTGGCTCGTTTCCTCGGGCCAGAGACGCTATCTCATCTATCGACGCTGATTCTCGGCGGCGAG
GCCGTCTTGCCCAGCGATGCCTTACTGGCTGGGGACAAGACAAAGATCATCAACGTCTACGGCCCTGCCGAATGC
ACGCCGACGATCACGCTGGCCCCCGTCGTCAAGGAAGACAAGGACGGCGTCACCATCGGCCGCGGAGCCGGCGTC
TGCACCTGGGTCGTCCACCCAGAAGACGACTCGTGCCTGGCTCCCATCGGAGCTGTGGGCGAGCTCTGGGTCGAA
GGACCACTCGTGGGCCGCGGCTATCTCAACGACGCGGAGAAGACGGCAGCCGCCTTCGTCCAGGACCCCGTCTGG
CTGACACAGGGTGGACGCAGCGGACGCGTCTACCGAACGGGCGACCTCGTCCGCTATCGCGAAGACGGTTCGTTG
CTGTTCGTTGGCCGCAAGGACACGCAGGTCAAGATCCGGGGACAGCGCATCGAGCTCGGCGAGGTCGAGCATCAC
GTTCTGCGAGCTTTGGAGCCGGTCGAGGGCGTCGATGTTTCCAATGCTCAGGTCGTGGCCGAGACCATCAAGCCG
GACGAGGCCAAGGGTGCCATCCTGGTTGCCTTCATCGTTCTCGAAAGCGCTGCCTCGACGTCTGAGAAGGACCAC
GCGGCCGCCGTGGCCAAGTTGACGCACGGTTTGGCAGACCGACTGGCGCTGACTCTTCCCGGGTTCATGATCCCT
TCAGCCTTCATTCCGGCGCACGGTATCCCCATGTCTGGCACGGGCAAGACGGATCGGCGCCTGCTCCAGACTATG
GGCGCCGCCTCGTGGCTTCGGCACCGCGCCGCGGCAGACAAGGTCGAGCCGGCGACGGACCTGACGGAACTGGAG
AAGCTGTTGCAGCAAATCTGGATATCGGTTCTCTTATTGCTACCGGAGGAAGCTTCGGTCAACAAGCTCTTCACT
CGTCTCGGAGGCGACTCTATCTCGGCCATGCAGGTCGTCTCTCAGTGCCGGCTTCACGGCCTCTCCCTGACGGCC
AGCGACGTGCTGCAGGCCGGAACCATCCGCAAGCTGGCGCAGCGCTGCCAGACGGTCACAGGTCAGCAGCCTATC
GCTGAGAGCAGCAGCGAAGACGAGACCGCCGGCAACGAACCCTTCGACTTGACGCCCATCCAGCAAATGTTCTTC
GAAGCCTACCCTGACGGACTGGATCACTATAACCAGAGCTTCATCCTCGACCTGGGCCAGCCGGCCTCGATCAAG
ACGCTACGAGCGGCAATGCGCGCCCTCGTCAGCCGCCACGAGATGCTCCGCGCCCGGTACTTCAAGGACGTCTCT
GCCGGAGACCGCTGGCGACAGCGTATCCTCGACGAGGACGACGACACGGCCTATGCCTTTACTCATCAGGCCGTG
GCTCGCCGCGACGACATGGCTGAAGCGGCACAGCGCCGTCAGGAGACACTCGATATTCGCACCGGGCCAGTCTTC
GCCTGTGACGTCTTTGACGTGGCCGGCGAGCAATCCCTTGTGCTCTCGGCTCATCATTTGGTCATCGACCTCGTC
TCATGGCGCATCATCTGGGCCGACATTGAGGACTTTGTACGTCAGGGCTCCATGCGAAGCCAGCGAACGGCATCC
TTCCGTGCCTGGTGCCGCCGCCAGGCCCGCGTCGGCTCCGGCCTCTCGCCGCTTGACGTGCTCCCCTTCCCTGTG
CCGGCTCCGGAGCTCGGCTTCTGGGCTCTGCCGGCACGGGAAAATACCTTCGGTGATTGCGTTAACCTAACGGAG
ACGATCGGTCGCGAGACCAGCACTCTGGTGCTCGGTGACGCAAATGATAGCCTTCGGACCGAGCCCGTCGACTTG
CTCGTCGCCTCCGTTGTTCATTCCTTTGTGCGGGCCTTCCCCGAGCGTCCTCCGCCTGTCGTCTGGCTCGAGGGC
CACGGCCGCGAGCAATCAGCCGAGCTGCCTTACGATGTTTCCGAGACGGTCGGCTGGTTCACCACCATGTATCCC
GTGCCGGTGCCCGCCGCCGCCGCTGGAGGCTCGCTGCTAGAGGCCGTTCGCACGGCAAAGGACACGCGCCGCAAG
GTGCCAGGCAAGGGCCAGCCATACTTTGCCTGTCGCTATCATAGCGTTGCCGGTCGTGAAGCCTTTGCGGGACAC
GACGTGGCTGAGATTACCCTCAACTTTACCGGTCGCTACCAGCAGCTCGAGAGCGAGGAGAGCCTCTTTGGTCGT
GCTGAGCAGCCGGCCGAGGCAGAGCGGTCAATTACCGAAGTTTCTGAATCTGCGCCGCGCACCGCTATGATCGAG
ATCAACGCTGGAGTTGAGGATGGCCGCCTGGGCGTATCGTTCTGCTTCCATCGCCGAATGCGCCATCAGGACCGT
CTCCGTCGCTGGGCAGAGAATGGTTTTGGAGCCGCCCTGTCTTCTCTGGCACGCGAGCTCCGACAAGCTCCCTCT
GCTCCTACGCTCACCGATCTGCCGCTGCTGCCGCTGTCTTACCACGGACTGGATGAGCTGCTGCTCCGCCAGTTG
CCCGCCATGGGCATTCGACCGGAGAACGTCACTGACATGTATCCGTGCTCGCCGCTGCAAGAGGGCATTCTGCTG
AGCGCCTTTAAGGGGGCTGCCACTTACGACACCTTCTCCGTCTACCGCTGCGCTCCGAATGTGGCCGGAAGCTCC
GTGTCTCCCGCTCGGCTTGAGGCGGCATGGCGTCGCGTCGTGGCTCGGCACTCGATTCTGTCGACCGTCTTCACC
CTCCATCCAGAAGGCGGCGGATTCGTTCAGATCGTTGTGCCCGAGTCGCCGGTCCGTGTCGCCCACACGACGTCG
TCCGGGTCGAGCCCCGTCGCTGCCCTGAGTCTGATTGAGCGGCCAGTGTTCGGCCCCGGCGATCCGCGCGTCGCC
TTCACCGTTTGCCGGTCCGACGCGGGCGACATCGCCGTCCGTCTGGACCTCAGCCATGCCCTCATTGACGCCTAC
TCAATGTCGATTCTCGTGCAGGAGCTGGTAGCGGCCTACGACGATTGCGAGATGCCGTCAGCGCCGAGCTTCATT
GACATGGTTCGCTTCATCGACTCGACCCCCAAGGCCCAGCGCTTGGCCTCTTGGACGGCGCTACTCGAGGGCGTC
GAGCCGTGCGTCGTGCCCGTGACGGAGCCGTCGCCGGGCCTCGATGTCGATGAGGGCCACGGTGACGTCTCGCTG
CCGACCAACCTGGCTTCGGCCATCACCGGCTTCTGTCGCGAGATGGGCATCACTCGTTCCGTCTTCCTGCAGGTG
GCCTGGTCCATGGCCCTCTCGCACTTCACCGGCATGCAAGAGGCCTGCTTCGGCTATCTCGCGTCCGGTCGCGAC
GCGCCCGTTGACAAGATTGAGACCATGGTTGGGCCTCTGGCCAACCTGCTCATTGGCCGCATCGACCTGCGTCGT
CCGGCTCGTCAGGTGCTAGAAAAGGCGCTGCAGCACTCCATCGAGCATCTCTCCATGCAACACGCGTCGTTGGCC
GAGATTCAGCATCACCTCGGGATATCCGGCCGGCGTCTGTTCAACACGTCGCTGTCGATCCGCGAGGCCGACAAG
CTCAAGGCTACCGACAACAGGACCATTACCCTGGACAGTGACGTGGGCGAGGATCCCCATGAGTATGATCTGAGC
TTGAGCGCCAACATCGATGGTGCCAAGATGGACATTGTCATGGAGTACCGCGAGCCCTACATTAGCAAGGGCGTC
GCCCGTGAAGCGTGTATCACGCTCGAAAAGGCCATCGACTACCTTTTGTCGGTTGGCGCCGATGAAGAAAACCTG
GAACCACTCTTCGATGGCTTCTTCAAGCGCGTCGTCGGGGCCGACCAGGACTCGGCATCAGCCTTCTGGAAGGCT
CAATTCGCCGGCATCCAGGGATCCAACTTCCCGCCTGTCAAGTCGGGCGCCAGTCACGCCGAGCTCGACGGCCGA
GTCCAACTCGACATCTCCGGCCTCAACTGGGACCGCGCCGACTGCACCGCTCTGGTCCGCGCCGCCTGGTCCATG
GTGACGGCCCGTAGCATGGGTTCCGACGAGATCTCGTTCGGCGCCGTCGTCGGCAGCCAAGACGCCCCGGCCGTG
GTGCCCGTCCGCGTTCAGCTGGACTGGGAGGCCGGCACGGAAAAGCTCCTTGGAGACATCCGGAGCCAAGCCGCC
GTCATGGCAACCTACCAGCACACAGGTCTGGCACGTATCCGCTGCATGAGCGACGAGGCTGCTTTGGCCTGCGAC
TTCAAGACGCTGCTTGTCATCCGCTCCGCCGAGGAGCAGGTCGAGTCGAACCGTGACGGTTCACACGCCATGCTA
GTCGAGGTCGAGACTCGCAACGCCGACGATGCACGCGTCTGCATCACCTTCGACTCCCACAGCATCAGTGAGGCT
CGCGTCTCGCGCGTCACCCACCAGTTTCAGCACGTCCTTCGCCAGCTCGCCGGCCCGGCCAAGGCCAGACTGCGC
GACATCACTGTCGTGAGCCAGCGCGACCTCGACGACATTTGGACTTGGAATGCTACCGTTCCCGCCTTGGTTGAG
GGTTGTCTTCACGACCTGATTGAACAGCGTGCTCGCGAGCAGCCCCTGGCTCCGGCCATCGACGCCTGGGACGGC
AGCCTGACGTACGGCCAGCTGAGCGAGCTCTCGACGCGATTGGCCCACCAGCTAGTCGGCCAAGGCGTTCAACAA
GGATGCGTTGTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTTGCGGCGTTGGCCGTCATGAAGGCCGGC
GGTGCCTCCGTGGCCGTCGATTCGACCCAGCCCGAGGAGCGTATCCGTGTTATTGCCACGCAGGCACGGTCGGCT
GGTCGGCTCGTCGTTGTTTGCTCCATCGCCAATGAGGCTCTCGTTCGGCGGCTGGAGCCCGACGCCCTCGTCAGC
ATTGGTCTCGATCGACTTCCGGAATCCCTCCCGGAGCGTTATCCCGTGCTTCCAACCGTTAGCCCGACTGACGTC
CTCTACATCGTCTTCACCTCGGGCAGTACGGGTCGGCCCAAGGGCGCCATCGTCTCTCACCAGAACTTCTATAGC
GCCGTCGTGTACCAACGAGACGATCTTGGCTACCGCAGCAATAGCCGCGTCTTCGACTTTGCATCGTATGCCTTC
GATATCGCTTGGTCAAACCTGCTTAATACGCTCACGGCGGGAGCTTGCCTATGTATTCCATCAGCGGCGGAACGC
GAGAACAACCTACCTGGCAGTCTCGAGAAGTATAGAGTCACTGTCGCCGATCTCACACCTTCGGTAGCCCGCTTT
ATCGAGCCCAAGTCGTCGCTATCAAACCTCTCGACGCTCCTGCTCGGAGGCGAAGTCGTACTGCCTAGCGACGCG
CTCATCGTGCCCGATCACACTCTCGTCGTTAGCGCCTACGGACCGGCCGAATGCACGCCTACGAGTACTATCCTG
CACCTCAAGAGTTCGAGCGAAATGGGCATCGGCCGCGCCGCAGGTCTCTGCACCTGGGTCGTCGACATGGACAAC
CCCGAGGCGCTGGCCCCGATTGGAGCCATCGGCGAGCTGTGGCTCGAGGGCCCGCTTGTCGGTTTAGGCTACCTC
GACGAGCCGGAAAAGACGGCAGCCGCCTTTATTCAGGATCCAGAGTGGCTTGTGCGCGGAGCTCCTGGCACGCGA
GAGGGCCGTCGAGGATCCGTCTACCGCACAGGAGATCTGGTCCAGTACAAAGAGGACGGAACTCTTCTCTTCGTT
GGCCGAAAGGATACTCAAGTCAAGATCAGGGGCCAGCGCGTGGAGCTGGGCGAGGTTGAGCACCACGTGCTGCGG
GCCATCAAGGCAGCCGAACCGGCAGCCAGCTTCCAGATTATCGCCGAGACGATTCAGCCCAAGGGCGCCGACTCA
AAGACGCTGGTTGCCTTTGTGGCCCTCGACGGCGCAAAGGACATGACGCCTGACGAGTACGACGACAAGGTCCGA
CAGGCGACGGCCGGCCTTAACGACCGACTGGCCGAGACTCTACCCGTCTTCATGCTTCCCACAGCCTATGTCCCT
CTTCAGACGGTGCCCATGATGGCCACCGGCAAGGCCGACCGCCGACAGCTGCGAGCCATCGGGTCGTCGCTCTCG
ACCAGAGATATCGCCCGCCTCAGCCGCGTCGAGGGAGACCGTCGGCCTCCGCGGACCGATTCCGAGCGCACTATG
CAGGCGTTATGGGCTGAGGTGCTAAAGGTTGATCCGGAGAGCATTGGAATCGATGATAGCTTCTTCCGCATCGGC
GGTGATTCCATCGGTGCCATGCGCCTCGTCGGTATCGCTCGTCAGCAAGGTCTTGGTCTGTCCGTCCGAGACATT
TTCCAGAATCCAGTACTTCGCGACCTCGCAGCCGTCGAGAACCATTCGAGCGTTCCGAGT
Transcript >Ophio5|5820
ATGAGATACCACATCGACCCAGTCTGCAACGGAAACGGAGTCTGGCACGCCAACCGCTCGACGACGCGCAAAGAG
GTCGCCAAGGAGACGCTCCCACGAGCCCTAGACGACATCTGGACTCGTAATGCCGTCGTTCCCGAGTCCGTCGAG
GCTTGCGTTCACGGCCTCATCAAAAGAATTGTCTGTGAGCAGCCGTCTGCACCGGCCGTCTGCTCGTGGGATGGC
AATCTAAGCTACGGCGAGCTCGACAAGCTCTCGAGCAATCTCGCCCGACAACTGGTTCAATTGGGAGTCGGCCCG
GCCACCATGGTTCTCTTGAGCTTCGAAAAGTCGGTTCTAATGCCCATTGCCGCGCTGGCCGTCATGAAGGCCGGC
GGCGCTTCCGTCGCCCTCGACGTCACCCAGCCAGAGGACCATCTGCGCATCCTCGCCTCACGGGTGTCCGCCCCC
TTCATCCTCTCCTCAGCCGCCAACGAGTCTCTGGCCAGACAACTCGGCGGCCATGTCTTAGTCGTCGACCGAGAG
CAGCTCGCCGGCCCGCCAACCAAGCAGCTCCAGCATGAACTATTTCCTCTCGTCACTCCGTCCGACGTCCTCTAC
GTCGTCTTCACCTCGGGCTGTACCGGTGCTCCTAAGGGGGCCGTCATCACGCACCGCAACTTTAGCAGCGCCATC
GCGTACCAGCAAAAGGCCCTAGGCTTCACCAGCAGCTCCCGCGTGTACGACTATGCTTCTTACGCTTCCCACGTG
GCGTGGTACAACCTTGTGCACGCACTGACGTGTGGTGGCTGTCTCTGCATCCCATCTGAGGCTGACCGGCGGTCT
AACGTGTCGGCATCTATTGCCGAGCTGGGCGCCAACTACGCCCAGTTGCCACCCTCGGTAGCACGGGCTCTTCAT
CTGTCCCAGCTTCCGGCTCTGCGGCAATTGAATCTTGTAGGCGAGCCCTCGAGCCCTCTCGAGGCCGAAGAGCTG
GGTCGGGCCGACATAGCCACCGTCAGCGCTTATGGTCTCTCCGAGACAGCGTCTCTGGCCGTAGTGTGGGCGGCC
AATGGTGCCGAGTCTGTACATCAGCCGCCGGCCGGCGTGTGCGCATGGGTTGTCGACTCGGAAGATCCGCGATCC
CTAGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTAGAAGGGCCGCTGGTCGGTCCGGGGTACCTCAATGATCCA
GACCGGACCGCCGCCGCCTTTGTCCAAGACCCGGAATGGCTTCTCCGCGGCACACCCAAATGGCCCGGGCGCCGA
GGGCGAACCCATCGCACAGGCGATTTGGTCCGCTACGACGACAATGGCCAGCTTGTCTTCGTCGGTCGTCGAGAG
CAGCCTCGCGTCGGCGGAGGCAAACGAGTTGACCCCAGCGCTATCGAGCACCATTTACGCCAGGCTGCCCTGCCG
CTCATCGACAATAACGAAGACGACTTTGACGGCCTGCAACTCATCGCCGAGACGATTCAGCCGCAGGGAGCCGAA
TCTGCTGTTCTTGTCGCCTTCGTCGCCCTCGATGGAGCCAGAGACATGCCAGATGAAAGGTACGGCGAAGCGGCG
CACCGGGTGGCAGCCCGTCTATCCGAGGGCCTATCCGCTGCTCTGCCGCCTCACATGGTTCCCGAGGCCTTCATC
CCGATCCAGGCCGTACCTATGACAGCAACTGGCAAAATCGACCGCCACTGTCTGCGCTCCATCGGCTCGCTCCTC
ACCGAGCCGGAGATGGCACGCCTCCGAGGTGCCGGCCGGCCTGCGCCGCGCTCCGAAGCCGAGAGGCTCATGGCC
GAGCTGTGGGCTCAAGCGCTACAGACGGAGCTTTCATCCCTCGGCCGAGACGACGACTTCTTCGCCTCGGGCGGC
GACGCTACTGCCGCCTTGCGTCTCTCCCGCCTCGCTCGCGAGCGGAAGCTCCCGCTAGAGGCACGCGAAGTCTTT
CGGACGCCCCGGTTACGCGACATGGCGGCCTGGGCGGCCACGCAAACCCCCTGGGCGGCCACGCAGAAGTCTTCC
CCCTTGGCGGCCACGGAAATGATATCCTCCCCCTTGGCAGCCTTCCCGCCTCCCCTGTCGCTGCTGGAGCGCCCC
GTGGACGAGGCCGAGATCCGGGCCCAGGCGGCGCGCCTTTGCCGCGTGTCAGATGCCTTGGTTCTCGATGTTCTG
CCTTGTACGCCCCTGCAGGCTGGCCTCCTTGCCTTGACGGCACAGCAAGCCGGCGCCTACGTGGCTCACAACGTC
TTCGAGCTGGGCCCGGACGTTGACGTGAACCGGTTCCGCGCCAGCTGGGACCAGGTAGTGGCCCTTAACCCGATC
CTGCGGACGCGCATCGTCAGTTTGCCGCGTCACGGCGTTGTCCAGGTCGTGCTGGAGGAGGGAGCTCACTGGTAC
TCCGGCTCTGGCTGCGCCGACGACTACCGCCTCGACAAGGCCTCCCGCACCATGGGCCTTGGGACCCCTCTTTCT
CGCTTTGCCCTGTTTGAGGACGGCGGCCCGCGGCAGTTTGTGTGGGAGGTTCATCACGCCCTATACGACGGCTGG
TCGCTGCCGCTGCTGATGCAGGAAGCTGAGCACGTCTACTACGGCGAGTTCAGCCCGCCCTTGGAGCCCATGACC
AACCTCATCAAGTACATCTCAGAGCGCGACGAAGCGACTACAAAGGCCTTCTGGCAGGCTCAATTTACCGGAATC
AAGGGGGCCCACTTCCCGGCCCCGAGGTCAGCCGCGCCGTACGAGCCCCGCCCCGATTCGCAGATGACCCGGGCC
GTGTCCGGTCTGGAGTGGGGCCGAGGCGACGTCACCCCGGCCTCCGTCATCCGGGCCGCCTGGGCAATCATGGTC
GCCCATAGCGCCGATTCGGATGAGGCTCTGTTTGGACTGACCGTGACGGGCCGACAGGCGGCGGTGCCCGGCATT
GAGCGCATGGCTGGACCGGCCATCGCCACCGTCCCAGTGCGCGTAGTTGTCGACTGGGACGACAGCGTGAGCCGC
CTGCTGGGAGCCGTCCAGCGCCAGGCAGCCGACATGATCCCTTACGAGCAGACGGGTCTGCAGAGGATCCGCCGC
GTAAGCGAGGCCGCCGCCGTTGCCTGTAGCTTCCAGTCGCTCCTCGTCATCCAGCCCGGCGGAGGAGGTGATGCA
GACAGTTCGGACACGGCCGGCCGCGTCTTCTTGACGGAACCAGCCGTCGACCACCACGCGACGACGCAGTGGCAA
GACTTTAGCACCTATGCTGTCGTCGTCGAATGCCAGCTCGACTCCGACGAGGTCCGACTTCGCATCGGCTTCGAC
TCGACCGTCGTCGGCCGCCAGCAGATGGATCGAATTGCCCGCGGCTTCGAGAGTGTTTTGCGCCTGCTGTGCGCT
GAGAAACGCGCCAAGGACAGGCTCCGGGCCGCCGTCGTGCCCAGCCTCTCCCAGGCGTCCATCGACGATATCTGG
CGCTGGAACGCCACCGTCCCGGCCGCCGTCGAGGGCCGCATCCACGACCTGGTGTCCCAGAGGGCTCGGGAACGA
CCTCAGGCGCCGGCCGTATGCGCCTGGGACGGAGAGCTCACGTATGGACAACTAGACGATCTCTCCACCAAACTT
GCTCTTAACCTAGTGGCCCGAGGCGTGACCGGCACCATTGTCCCACTCTTTTTCGAAAAGTCCATGTGGATGCCG
GTAGCCGCTCTCGCCGTAATGAAGGCCGGCGGCGCATCTATCGCCATGGAAACGACGCAACCCGAGGAGAGGCTT
CGGGGCATCGCCGCCCAGGCCGATTCGCCCGTTGTGCTGGCTTCGGTGCAAAAGAGCGCCCTGGCCCGAGGCTTG
GTCTCCGCAGAGGTCATGACCGTCGGACCCAACCAGCCGGCTCCGGACGCCGACTCCAAGGAGGTGGCGTCATTG
CCCGTCGTCGACCCGTCAAGCATCCTATACATTGTCTTCACATCCGGCAGCACGGGAACGCCTAAGGGCGCCATC
GTGACCCATAGTAACTTTGCCAGCGCCGCCGCCTATCAGCAGCTGCCGCTAGGCTACGACGCCAACTCGCGCGTA
TTCGACTTCGCGTCTTACGCCTTTGACGCTTCGTGGTATAACCTTCTCAACGCCCTAACCGTCGGCGGCTGTCTC
TGTATCCCCTCTGCCGAGGAGCGCGAAAACAACCTCAGCGGCTCTATAGAGAAGTACAAGGTTACGACGGCGGAC
CTGACGCCTTCAGTGGCTCGTTTCCTCGGGCCAGAGACGCTATCTCATCTATCGACGCTGATTCTCGGCGGCGAG
GCCGTCTTGCCCAGCGATGCCTTACTGGCTGGGGACAAGACAAAGATCATCAACGTCTACGGCCCTGCCGAATGC
ACGCCGACGATCACGCTGGCCCCCGTCGTCAAGGAAGACAAGGACGGCGTCACCATCGGCCGCGGAGCCGGCGTC
TGCACCTGGGTCGTCCACCCAGAAGACGACTCGTGCCTGGCTCCCATCGGAGCTGTGGGCGAGCTCTGGGTCGAA
GGACCACTCGTGGGCCGCGGCTATCTCAACGACGCGGAGAAGACGGCAGCCGCCTTCGTCCAGGACCCCGTCTGG
CTGACACAGGGTGGACGCAGCGGACGCGTCTACCGAACGGGCGACCTCGTCCGCTATCGCGAAGACGGTTCGTTG
CTGTTCGTTGGCCGCAAGGACACGCAGGTCAAGATCCGGGGACAGCGCATCGAGCTCGGCGAGGTCGAGCATCAC
GTTCTGCGAGCTTTGGAGCCGGTCGAGGGCGTCGATGTTTCCAATGCTCAGGTCGTGGCCGAGACCATCAAGCCG
GACGAGGCCAAGGGTGCCATCCTGGTTGCCTTCATCGTTCTCGAAAGCGCTGCCTCGACGTCTGAGAAGGACCAC
GCGGCCGCCGTGGCCAAGTTGACGCACGGTTTGGCAGACCGACTGGCGCTGACTCTTCCCGGGTTCATGATCCCT
TCAGCCTTCATTCCGGCGCACGGTATCCCCATGTCTGGCACGGGCAAGACGGATCGGCGCCTGCTCCAGACTATG
GGCGCCGCCTCGTGGCTTCGGCACCGCGCCGCGGCAGACAAGGTCGAGCCGGCGACGGACCTGACGGAACTGGAG
AAGCTGTTGCAGCAAATCTGGATATCGGTTCTCTTATTGCTACCGGAGGAAGCTTCGGTCAACAAGCTCTTCACT
CGTCTCGGAGGCGACTCTATCTCGGCCATGCAGGTCGTCTCTCAGTGCCGGCTTCACGGCCTCTCCCTGACGGCC
AGCGACGTGCTGCAGGCCGGAACCATCCGCAAGCTGGCGCAGCGCTGCCAGACGGTCACAGGTCAGCAGCCTATC
GCTGAGAGCAGCAGCGAAGACGAGACCGCCGGCAACGAACCCTTCGACTTGACGCCCATCCAGCAAATGTTCTTC
GAAGCCTACCCTGACGGACTGGATCACTATAACCAGAGCTTCATCCTCGACCTGGGCCAGCCGGCCTCGATCAAG
ACGCTACGAGCGGCAATGCGCGCCCTCGTCAGCCGCCACGAGATGCTCCGCGCCCGGTACTTCAAGGACGTCTCT
GCCGGAGACCGCTGGCGACAGCGTATCCTCGACGAGGACGACGACACGGCCTATGCCTTTACTCATCAGGCCGTG
GCTCGCCGCGACGACATGGCTGAAGCGGCACAGCGCCGTCAGGAGACACTCGATATTCGCACCGGGCCAGTCTTC
GCCTGTGACGTCTTTGACGTGGCCGGCGAGCAATCCCTTGTGCTCTCGGCTCATCATTTGGTCATCGACCTCGTC
TCATGGCGCATCATCTGGGCCGACATTGAGGACTTTGTACGTCAGGGCTCCATGCGAAGCCAGCGAACGGCATCC
TTCCGTGCCTGGTGCCGCCGCCAGGCCCGCGTCGGCTCCGGCCTCTCGCCGCTTGACGTGCTCCCCTTCCCTGTG
CCGGCTCCGGAGCTCGGCTTCTGGGCTCTGCCGGCACGGGAAAATACCTTCGGTGATTGCGTTAACCTAACGGAG
ACGATCGGTCGCGAGACCAGCACTCTGGTGCTCGGTGACGCAAATGATAGCCTTCGGACCGAGCCCGTCGACTTG
CTCGTCGCCTCCGTTGTTCATTCCTTTGTGCGGGCCTTCCCCGAGCGTCCTCCGCCTGTCGTCTGGCTCGAGGGC
CACGGCCGCGAGCAATCAGCCGAGCTGCCTTACGATGTTTCCGAGACGGTCGGCTGGTTCACCACCATGTATCCC
GTGCCGGTGCCCGCCGCCGCCGCTGGAGGCTCGCTGCTAGAGGCCGTTCGCACGGCAAAGGACACGCGCCGCAAG
GTGCCAGGCAAGGGCCAGCCATACTTTGCCTGTCGCTATCATAGCGTTGCCGGTCGTGAAGCCTTTGCGGGACAC
GACGTGGCTGAGATTACCCTCAACTTTACCGGTCGCTACCAGCAGCTCGAGAGCGAGGAGAGCCTCTTTGGTCGT
GCTGAGCAGCCGGCCGAGGCAGAGCGGTCAATTACCGAAGTTTCTGAATCTGCGCCGCGCACCGCTATGATCGAG
ATCAACGCTGGAGTTGAGGATGGCCGCCTGGGCGTATCGTTCTGCTTCCATCGCCGAATGCGCCATCAGGACCGT
CTCCGTCGCTGGGCAGAGAATGGTTTTGGAGCCGCCCTGTCTTCTCTGGCACGCGAGCTCCGACAAGCTCCCTCT
GCTCCTACGCTCACCGATCTGCCGCTGCTGCCGCTGTCTTACCACGGACTGGATGAGCTGCTGCTCCGCCAGTTG
CCCGCCATGGGCATTCGACCGGAGAACGTCACTGACATGTATCCGTGCTCGCCGCTGCAAGAGGGCATTCTGCTG
AGCGCCTTTAAGGGGGCTGCCACTTACGACACCTTCTCCGTCTACCGCTGCGCTCCGAATGTGGCCGGAAGCTCC
GTGTCTCCCGCTCGGCTTGAGGCGGCATGGCGTCGCGTCGTGGCTCGGCACTCGATTCTGTCGACCGTCTTCACC
CTCCATCCAGAAGGCGGCGGATTCGTTCAGATCGTTGTGCCCGAGTCGCCGGTCCGTGTCGCCCACACGACGTCG
TCCGGGTCGAGCCCCGTCGCTGCCCTGAGTCTGATTGAGCGGCCAGTGTTCGGCCCCGGCGATCCGCGCGTCGCC
TTCACCGTTTGCCGGTCCGACGCGGGCGACATCGCCGTCCGTCTGGACCTCAGCCATGCCCTCATTGACGCCTAC
TCAATGTCGATTCTCGTGCAGGAGCTGGTAGCGGCCTACGACGATTGCGAGATGCCGTCAGCGCCGAGCTTCATT
GACATGGTTCGCTTCATCGACTCGACCCCCAAGGCCCAGCGCTTGGCCTCTTGGACGGCGCTACTCGAGGGCGTC
GAGCCGTGCGTCGTGCCCGTGACGGAGCCGTCGCCGGGCCTCGATGTCGATGAGGGCCACGGTGACGTCTCGCTG
CCGACCAACCTGGCTTCGGCCATCACCGGCTTCTGTCGCGAGATGGGCATCACTCGTTCCGTCTTCCTGCAGGTG
GCCTGGTCCATGGCCCTCTCGCACTTCACCGGCATGCAAGAGGCCTGCTTCGGCTATCTCGCGTCCGGTCGCGAC
GCGCCCGTTGACAAGATTGAGACCATGGTTGGGCCTCTGGCCAACCTGCTCATTGGCCGCATCGACCTGCGTCGT
CCGGCTCGTCAGGTGCTAGAAAAGGCGCTGCAGCACTCCATCGAGCATCTCTCCATGCAACACGCGTCGTTGGCC
GAGATTCAGCATCACCTCGGGATATCCGGCCGGCGTCTGTTCAACACGTCGCTGTCGATCCGCGAGGCCGACAAG
CTCAAGGCTACCGACAACAGGACCATTACCCTGGACAGTGACGTGGGCGAGGATCCCCATGAGTATGATCTGAGC
TTGAGCGCCAACATCGATGGTGCCAAGATGGACATTGTCATGGAGTACCGCGAGCCCTACATTAGCAAGGGCGTC
GCCCGTGAAGCGTGTATCACGCTCGAAAAGGCCATCGACTACCTTTTGTCGGTTGGCGCCGATGAAGAAAACCTG
GAACCACTCTTCGATGGCTTCTTCAAGCGCGTCGTCGGGGCCGACCAGGACTCGGCATCAGCCTTCTGGAAGGCT
CAATTCGCCGGCATCCAGGGATCCAACTTCCCGCCTGTCAAGTCGGGCGCCAGTCACGCCGAGCTCGACGGCCGA
GTCCAACTCGACATCTCCGGCCTCAACTGGGACCGCGCCGACTGCACCGCTCTGGTCCGCGCCGCCTGGTCCATG
GTGACGGCCCGTAGCATGGGTTCCGACGAGATCTCGTTCGGCGCCGTCGTCGGCAGCCAAGACGCCCCGGCCGTG
GTGCCCGTCCGCGTTCAGCTGGACTGGGAGGCCGGCACGGAAAAGCTCCTTGGAGACATCCGGAGCCAAGCCGCC
GTCATGGCAACCTACCAGCACACAGGTCTGGCACGTATCCGCTGCATGAGCGACGAGGCTGCTTTGGCCTGCGAC
TTCAAGACGCTGCTTGTCATCCGCTCCGCCGAGGAGCAGGTCGAGTCGAACCGTGACGGTTCACACGCCATGCTA
GTCGAGGTCGAGACTCGCAACGCCGACGATGCACGCGTCTGCATCACCTTCGACTCCCACAGCATCAGTGAGGCT
CGCGTCTCGCGCGTCACCCACCAGTTTCAGCACGTCCTTCGCCAGCTCGCCGGCCCGGCCAAGGCCAGACTGCGC
GACATCACTGTCGTGAGCCAGCGCGACCTCGACGACATTTGGACTTGGAATGCTACCGTTCCCGCCTTGGTTGAG
GGTTGTCTTCACGACCTGATTGAACAGCGTGCTCGCGAGCAGCCCCTGGCTCCGGCCATCGACGCCTGGGACGGC
AGCCTGACGTACGGCCAGCTGAGCGAGCTCTCGACGCGATTGGCCCACCAGCTAGTCGGCCAAGGCGTTCAACAA
GGATGCGTTGTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTTGCGGCGTTGGCCGTCATGAAGGCCGGC
GGTGCCTCCGTGGCCGTCGATTCGACCCAGCCCGAGGAGCGTATCCGTGTTATTGCCACGCAGGCACGGTCGGCT
GGTCGGCTCGTCGTTGTTTGCTCCATCGCCAATGAGGCTCTCGTTCGGCGGCTGGAGCCCGACGCCCTCGTCAGC
ATTGGTCTCGATCGACTTCCGGAATCCCTCCCGGAGCGTTATCCCGTGCTTCCAACCGTTAGCCCGACTGACGTC
CTCTACATCGTCTTCACCTCGGGCAGTACGGGTCGGCCCAAGGGCGCCATCGTCTCTCACCAGAACTTCTATAGC
GCCGTCGTGTACCAACGAGACGATCTTGGCTACCGCAGCAATAGCCGCGTCTTCGACTTTGCATCGTATGCCTTC
GATATCGCTTGGTCAAACCTGCTTAATACGCTCACGGCGGGAGCTTGCCTATGTATTCCATCAGCGGCGGAACGC
GAGAACAACCTACCTGGCAGTCTCGAGAAGTATAGAGTCACTGTCGCCGATCTCACACCTTCGGTAGCCCGCTTT
ATCGAGCCCAAGTCGTCGCTATCAAACCTCTCGACGCTCCTGCTCGGAGGCGAAGTCGTACTGCCTAGCGACGCG
CTCATCGTGCCCGATCACACTCTCGTCGTTAGCGCCTACGGACCGGCCGAATGCACGCCTACGAGTACTATCCTG
CACCTCAAGAGTTCGAGCGAAATGGGCATCGGCCGCGCCGCAGGTCTCTGCACCTGGGTCGTCGACATGGACAAC
CCCGAGGCGCTGGCCCCGATTGGAGCCATCGGCGAGCTGTGGCTCGAGGGCCCGCTTGTCGGTTTAGGCTACCTC
GACGAGCCGGAAAAGACGGCAGCCGCCTTTATTCAGGATCCAGAGTGGCTTGTGCGCGGAGCTCCTGGCACGCGA
GAGGGCCGTCGAGGATCCGTCTACCGCACAGGAGATCTGGTCCAGTACAAAGAGGACGGAACTCTTCTCTTCGTT
GGCCGAAAGGATACTCAAGTCAAGATCAGGGGCCAGCGCGTGGAGCTGGGCGAGGTTGAGCACCACGTGCTGCGG
GCCATCAAGGCAGCCGAACCGGCAGCCAGCTTCCAGATTATCGCCGAGACGATTCAGCCCAAGGGCGCCGACTCA
AAGACGCTGGTTGCCTTTGTGGCCCTCGACGGCGCAAAGGACATGACGCCTGACGAGTACGACGACAAGGTCCGA
CAGGCGACGGCCGGCCTTAACGACCGACTGGCCGAGACTCTACCCGTCTTCATGCTTCCCACAGCCTATGTCCCT
CTTCAGACGGTGCCCATGATGGCCACCGGCAAGGCCGACCGCCGACAGCTGCGAGCCATCGGGTCGTCGCTCTCG
ACCAGAGATATCGCCCGCCTCAGCCGCGTCGAGGGAGACCGTCGGCCTCCGCGGACCGATTCCGAGCGCACTATG
CAGGCGTTATGGGCTGAGGTGCTAAAGGTTGATCCGGAGAGCATTGGAATCGATGATAGCTTCTTCCGCATCGGC
GGTGATTCCATCGGTGCCATGCGCCTCGTCGGTATCGCTCGTCAGCAAGGTCTTGGTCTGTCCGTCCGAGACATT
TTCCAGAATCCAGTACTTCGCGACCTCGCAGCCGTCGAGAACCATTCGAGCGTTCCGAGTTAG
Gene >Ophio5|5820
ATGAGATACCACATCGACCCAGTCTGCAACGGAAACGGAGTCTGGCACGCCAACCGCTCGACGACGCGCAAAGAG
GTCGCCAAGGAGACGCTCCCACGAGCCCTAGACGACATCTGGACTCGTAATGCCGTCGTTCCCGAGTCCGTCGAG
GCTTGCGTTCACGGCCTCATCAAAAGAATTGTCTGTGAGCAGCCGTCTGCACCGGCCGTCTGCTCGTGGGATGGC
AATCTAAGCTACGGCGAGCTCGACAAGCTCTCGAGCAATCTCGCCCGACAACTGGTTCAATTGGGAGTCGGCCCG
GCCACCATGGTTCTCTTGAGCTTCGAAAAGTCGGTTCTAATGCCCATTGCCGCGCTGGCCGTCATGAAGGCCGGC
GGCGCTTCCGTCGCCCTCGACGTCACCCAGCCAGAGGACCATCTGCGCATCCTCGCCTCACGGGTGTCCGCCCCC
TTCATCCTCTCCTCAGCCGCCAACGAGTCTCTGGCCAGACAACTCGGCGGCCATGTCTTAGTCGTCGACCGAGAG
CAGCTCGCCGGCCCGCCAACCAAGCAGCTCCAGCATGAACTATTTCCTCTCGTCACTCCGTCCGACGTCCTCTAC
GTCGTCTTCACCTCGGGCTGTACCGGTGCTCCTAAGGGGGCCGTCATCACGCACCGCAACTTTAGCAGCGCCATC
GCGTACCAGCAAAAGGCCCTAGGCTTCACCAGCAGCTCCCGCGTGTACGACTATGCTTCTTACGCTTCCCACGTG
GCGTGGTACAACCTTGTGCACGCACTGACGTGTGGTGGCTGTCTCTGCATCCCATCTGAGGCTGACCGGCGGTCT
AACGTGTCGGCATCTATTGCCGAGCTGGGCGCCAACTACGCCCAGTTGCCACCCTCGGTAGCACGGGCTCTTCAT
CTGTCCCAGCTTCCGGCTCTGCGGCAATTGAATCTTGTAGGCGAGCCCTCGAGCCCTCTCGAGGCCGAAGAGCTG
GGTCGGGCCGACATAGCCACCGTCAGCGCTTATGGTCTCTCCGAGACAGCGTCTCTGGCCGTAGTGTGGGCGGCC
AATGGTGCCGAGTCTGTACATCAGCCGCCGGCCGGCGTGTGCGCATGGGTTGTCGACTCGGAAGATCCGCGATCC
CTAGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTAGAAGGGCCGCTGGTCGGTCCGGGGTACCTCAATGATCCA
GACCGGACCGCCGCCGCCTTTGTCCAAGACCCGGAATGGCTTCTCCGCGGCACACCCAAATGGCCCGGGCGCCGA
GGGCGAACCCATCGCACAGGCGATTTGGTCCGCTACGACGACAATGGCCAGCTTGTCTTCGTCGGTCGTCGAGAG
CAGCCTCGCGTCGGCGGAGGCAAACGAGTTGACCCCAGCGCTATCGAGCACCATTTACGCCAGGCTGCCCTGCCG
CTCATCGACAATAACGAAGACGACTTTGACGGCCTGCAACTCATCGCCGAGACGATTCAGCCGCAGGGAGCCGAA
TCTGCTGTTCTTGTCGCCTTCGTCGCCCTCGATGGAGCCAGAGACATGCCAGATGAAAGGTACGGCGAAGCGGCG
CACCGGGTGGCAGCCCGTCTATCCGAGGGCCTATCCGCTGCTCTGCCGCCTCACATGGTTCCCGAGGCCTTCATC
CCGATCCAGGCCGTACCTATGACAGCAACTGGCAAAATCGACCGCCACTGTCTGCGCTCCATCGGCTCGCTCCTC
ACCGAGCCGGAGATGGCACGCCTCCGAGGTGCCGGCCGGCCTGCGCCGCGCTCCGAAGCCGAGAGGCTCATGGCC
GAGCTGTGGGCTCAAGCGCTACAGACGGAGCTTTCATCCCTCGGCCGAGACGACGACTTCTTCGCCTCGGGCGGC
GACGCTACTGCCGCCTTGCGTCTCTCCCGCCTCGCTCGCGAGCGGAAGCTCCCGCTAGAGGCACGCGAAGTCTTT
CGGACGCCCCGGTTACGCGACATGGCGGCCTGGGCGGCCACGCAAACCCCCTGGGCGGCCACGCAGAAGTCTTCC
CCCTTGGCGGCCACGGAAATGATATCCTCCCCCTTGGCAGCCTTCCCGCCTCCCCTGTCGCTGCTGGAGCGCCCC
GTGGACGAGGCCGAGATCCGGGCCCAGGCGGCGCGCCTTTGCCGCGTGTCAGATGCCTTGGTTCTCGATGTTCTG
CCTTGTACGCCCCTGCAGGCTGGCCTCCTTGCCTTGACGGCACAGCAAGCCGGCGCCTACGTGGCTCACAACGTC
TTCGAGCTGGGCCCGGACGTTGACGTGAACCGGTTCCGCGCCAGCTGGGACCAGGTAGTGGCCCTTAACCCGATC
CTGCGGACGCGCATCGTCAGTTTGCCGCGTCACGGCGTTGTCCAGGTCGTGCTGGAGGAGGGAGCTCACTGGTAC
TCCGGCTCTGGCTGCGCCGACGACTACCGCCTCGACAAGGCCTCCCGCACCATGGGCCTTGGGACCCCTCTTTCT
CGCTTTGCCCTGTTTGAGGACGGCGGCCCGCGGCAGTTTGTGTGGGAGGTTCATCACGCCCTATACGACGGCTGG
TCGCTGCCGCTGCTGATGCAGGAAGCTGAGCACGTCTACTACGGCGAGTTCAGCCCGCCCTTGGAGCCCATGACC
AACCTCATCAAGTACATCTCAGAGCGCGACGAAGCGACTACAAAGGCCTTCTGGCAGGCTCAATTTACCGGAATC
AAGGGGGCCCACTTCCCGGCCCCGAGGTCAGCCGCGCCGTACGAGCCCCGCCCCGATTCGCAGATGACCCGGGCC
GTGTCCGGTCTGGAGTGGGGCCGAGGCGACGTCACCCCGGCCTCCGTCATCCGGGCCGCCTGGGCAATCATGGTC
GCCCATAGCGCCGATTCGGATGAGGCTCTGTTTGGACTGACCGTGACGGGCCGACAGGCGGCGGTGCCCGGCATT
GAGCGCATGGCTGGACCGGCCATCGCCACCGTCCCAGTGCGCGTAGTTGTCGACTGGGACGACAGCGTGAGCCGC
CTGCTGGGAGCCGTCCAGCGCCAGGCAGCCGACATGATCCCTTACGAGCAGACGGGTCTGCAGAGGATCCGCCGC
GTAAGCGAGGCCGCCGCCGTTGCCTGTAGCTTCCAGTCGCTCCTCGTCATCCAGCCCGGCGGAGGAGGTGATGCA
GACAGTTCGGACACGGCCGGCCGCGTCTTCTTGACGGAACCAGCCGTCGACCACCACGCGACGACGCAGTGGCAA
GACTTTAGCACCTATGCTGTCGTCGTCGAATGCCAGCTCGACTCCGACGAGGTCCGACTTCGCATCGGCTTCGAC
TCGACCGTCGTCGGCCGCCAGCAGATGGATCGAATTGCCCGCGGCTTCGAGAGTGTTTTGCGCCTGCTGTGCGCT
GAGAAACGCGCCAAGGACAGGCTCCGGGCCGCCGTCGTGCCCAGCCTCTCCCAGGCGTCCATCGACGATATCTGG
CGCTGGAACGCCACCGTCCCGGCCGCCGTCGAGGGCCGCATCCACGACCTGGTGTCCCAGAGGGCTCGGGAACGA
CCTCAGGCGCCGGCCGTATGCGCCTGGGACGGAGAGCTCACGTATGGACAACTAGACGATCTCTCCACCAAACTT
GCTCTTAACCTAGTGGCCCGAGGCGTGACCGGCACCATTGTCCCACTCTTTTTCGAAAAGTCCATGTGGATGCCG
GTAGCCGCTCTCGCCGTAATGAAGGCCGGCGGCGCATCTATCGCCATGGAAACGACGCAACCCGAGGAGAGGCTT
CGGGGCATCGCCGCCCAGGCCGATTCGCCCGTTGTGCTGGCTTCGGTGCAAAAGAGCGCCCTGGCCCGAGGCTTG
GTCTCCGCAGAGGTCATGACCGTCGGACCCAACCAGCCGGCTCCGGACGCCGACTCCAAGGAGGTGGCGTCATTG
CCCGTCGTCGACCCGTCAAGCATCCTATACATTGTCTTCACATCCGGCAGCACGGGAACGCCTAAGGGCGCCATC
GTGACCCATAGTAACTTTGCCAGCGCCGCCGCCTATCAGCAGCTGCCGCTAGGCTACGACGCCAACTCGCGCGTA
TTCGACTTCGCGTCTTACGCCTTTGACGCTTCGTGGTATAACCTTCTCAACGCCCTAACCGTCGGCGGCTGTCTC
TGTATCCCCTCTGCCGAGGAGCGCGAAAACAACCTCAGCGGCTCTATAGAGAAGTACAAGGTTACGACGGCGGAC
CTGACGCCTTCAGTGGCTCGTTTCCTCGGGCCAGAGACGCTATCTCATCTATCGACGCTGATTCTCGGCGGCGAG
GCCGTCTTGCCCAGCGATGCCTTACTGGCTGGGGACAAGACAAAGATCATCAACGTCTACGGCCCTGCCGAATGC
ACGCCGACGATCACGCTGGCCCCCGTCGTCAAGGAAGACAAGGACGGCGTCACCATCGGCCGCGGAGCCGGCGTC
TGCACCTGGGTCGTCCACCCAGAAGACGACTCGTGCCTGGCTCCCATCGGAGCTGTGGGCGAGCTCTGGGTCGAA
GGACCACTCGTGGGCCGCGGCTATCTCAACGACGCGGAGAAGACGGCAGCCGCCTTCGTCCAGGACCCCGTCTGG
CTGACACAGGGTGGACGCAGCGGACGCGTCTACCGAACGGGCGACCTCGTCCGCTATCGCGAAGACGGTTCGTTG
CTGTTCGTTGGCCGCAAGGACACGCAGGTCAAGATCCGGGGACAGCGCATCGAGCTCGGCGAGGTCGAGCATCAC
GTTCTGCGAGCTTTGGAGCCGGTCGAGGGCGTCGATGTTTCCAATGCTCAGGTCGTGGCCGAGACCATCAAGCCG
GACGAGGCCAAGGGTGCCATCCTGGTTGCCTTCATCGTTCTCGAAAGCGCTGCCTCGACGTCTGAGAAGGACCAC
GCGGCCGCCGTGGCCAAGTTGACGCACGGTTTGGCAGACCGACTGGCGCTGACTCTTCCCGGGTTCATGATCCCT
TCAGCCTTCATTCCGGCGCACGGTATCCCCATGTCTGGCACGGGCAAGACGGATCGGCGCCTGCTCCAGACTATG
GGCGCCGCCTCGTGGCTTCGGCACCGCGCCGCGGCAGACAAGGTCGAGCCGGCGACGGACCTGACGGAACTGGAG
AAGCTGTTGCAGCAAATCTGGATATCGGTTCTCTTATTGCTACCGGAGGAAGCTTCGGTCAACAAGCTCTTCACT
CGTCTCGGAGGCGACTCTATCTCGGCCATGCAGGTCGTCTCTCAGTGCCGGCTTCACGGCCTCTCCCTGACGGCC
AGCGACGTGCTGCAGGCCGGAACCATCCGCAAGCTGGCGCAGCGCTGCCAGACGGTCACAGGTCAGCAGCCTATC
GCTGAGAGCAGCAGCGAAGACGAGACCGCCGGCAACGAACCCTTCGACTTGACGCCCATCCAGCAAATGTTCTTC
GAAGCCTACCCTGACGGACTGGATCACTATAACCAGAGCTTCATCCTCGACCTGGGCCAGCCGGCCTCGATCAAG
ACGCTACGAGCGGCAATGCGCGCCCTCGTCAGCCGCCACGAGATGCTCCGCGCCCGGTACTTCAAGGACGTCTCT
GCCGGAGACCGCTGGCGACAGCGTATCCTCGACGAGGACGACGACACGGCCTATGCCTTTACTCATCAGGCCGTG
GCTCGCCGCGACGACATGGCTGAAGCGGCACAGCGCCGTCAGGAGACACTCGATATTCGCACCGGGCCAGTCTTC
GCCTGTGACGTCTTTGACGTGGCCGGCGAGCAATCCCTTGTGCTCTCGGCTCATCATTTGGTCATCGACCTCGTC
TCATGGCGCATCATCTGGGCCGACATTGAGGACTTTGTACGTCAGGGCTCCATGCGAAGCCAGCGAACGGCATCC
TTCCGTGCCTGGTGCCGCCGCCAGGCCCGCGTCGGCTCCGGCCTCTCGCCGCTTGACGTGCTCCCCTTCCCTGTG
CCGGCTCCGGAGCTCGGCTTCTGGGCTCTGCCGGCACGGGAAAATACCTTCGGTGATTGCGTTAACCTAACGGAG
ACGATCGGTCGCGAGACCAGCACTCTGGTGCTCGGTGACGCAAATGATAGCCTTCGGACCGAGCCCGTCGACTTG
CTCGTCGCCTCCGTTGTTCATTCCTTTGTGCGGGCCTTCCCCGAGCGTCCTCCGCCTGTCGTCTGGCTCGAGGGC
CACGGCCGCGAGCAATCAGCCGAGCTGCCTTACGATGTTTCCGAGACGGTCGGCTGGTTCACCACCATGTATCCC
GTGCCGGTGCCCGCCGCCGCCGCTGGAGGCTCGCTGCTAGAGGCCGTTCGCACGGCAAAGGACACGCGCCGCAAG
GTGCCAGGCAAGGGCCAGCCATACTTTGCCTGTCGCTATCATAGCGTTGCCGGTCGTGAAGCCTTTGCGGGACAC
GACGTGGCTGAGATTACCCTCAACTTTACCGGTCGCTACCAGCAGCTCGAGAGCGAGGAGAGCCTCTTTGGTCGT
GCTGAGCAGCCGGCCGAGGCAGAGCGGTCAATTACCGAAGTTTCTGAATCTGCGCCGCGCACCGCTATGATCGAG
ATCAACGCTGGAGTTGAGGATGGCCGCCTGGGCGTATCGTTCTGCTTCCATCGCCGAATGCGCCATCAGGACCGT
CTCCGTCGCTGGGCAGAGAATGGTTTTGGAGCCGCCCTGTCTTCTCTGGCACGCGAGCTCCGACAAGCTCCCTCT
GCTCCTACGCTCACCGATCTGCCGCTGCTGCCGCTGTCTTACCACGGACTGGATGAGCTGCTGCTCCGCCAGTTG
CCCGCCATGGGCATTCGACCGGAGAACGTCACTGACATGTATCCGTGCTCGCCGCTGCAAGAGGGCATTCTGCTG
AGCGCCTTTAAGGGGGCTGCCACTTACGACACCTTCTCCGTCTACCGCTGCGCTCCGAATGTGGCCGGAAGCTCC
GTGTCTCCCGCTCGGCTTGAGGCGGCATGGCGTCGCGTCGTGGCTCGGCACTCGATTCTGTCGACCGTCTTCACC
CTCCATCCAGAAGGCGGCGGATTCGTTCAGATCGTTGTGCCCGAGTCGCCGGTCCGTGTCGCCCACACGACGTCG
TCCGGGTCGAGCCCCGTCGCTGCCCTGAGTCTGATTGAGCGGCCAGTGTTCGGCCCCGGCGATCCGCGCGTCGCC
TTCACCGTTTGCCGGTCCGACGCGGGCGACATCGCCGTCCGTCTGGACCTCAGCCATGCCCTCATTGACGCCTAC
TCAATGTCGATTCTCGTGCAGGAGCTGGTAGCGGCCTACGACGATTGCGAGATGCCGTCAGCGCCGAGCTTCATT
GACATGGTTCGCTTCATCGACTCGACCCCCAAGGCCCAGCGCTTGGCCTCTTGGACGGCGCTACTCGAGGGCGTC
GAGCCGTGCGTCGTGCCCGTGACGGAGCCGTCGCCGGGCCTCGATGTCGATGAGGGCCACGGTGACGTCTCGCTG
CCGACCAACCTGGCTTCGGCCATCACCGGCTTCTGTCGCGAGATGGGCATCACTCGTTCCGTCTTCCTGCAGGTG
GCCTGGTCCATGGCCCTCTCGCACTTCACCGGCATGCAAGAGGCCTGCTTCGGCTATCTCGCGTCCGGTCGCGAC
GCGCCCGTTGACAAGATTGAGACCATGGTTGGGCCTCTGGCCAACCTGCTCATTGGCCGCATCGACCTGCGTCGT
CCGGCTCGTCAGGTGCTAGAAAAGGCGCTGCAGCACTCCATCGAGCATCTCTCCATGCAACACGCGTCGTTGGCC
GAGATTCAGCATCACCTCGGGATATCCGGCCGGCGTCTGTTCAACACGTCGCTGTCGATCCGCGAGGCCGACAAG
CTCAAGGCTACCGACAACAGGACCATTACCCTGGACAGTGACGTGGGCGAGGATCCCCATGAGGTGAGCATGCGT
TAACTCTGTACCCCCTTTTACCCCTTGATTGAGCTGACACCAAGGACGATGAACAGTATGATCTGAGCTTGAGCG
CCAACATCGATGGTGCCAAGATGGACATTGTCATGGAGTACCGCGAGCCCTACATTAGCAAGGGCGTCGCCCGTG
AAGCGTGTATCACGCTCGAAAAGGCCATCGACTACCTTTTGTCGGTTGGCGCCGATGAAGAAAACCTGGAACCAC
TCTTCGATGGCTTCTTCAAGCGCGTCGTCGGGGCCGACCAGGACTCGGCATCAGCCTTCTGGAAGGCTCAATTCG
CCGGCATCCAGGGATCCAACTTCCCGCCTGTCAAGTCGGGCGCCAGTCACGCCGAGCTCGACGGCCGAGTCCAAC
TCGACATCTCCGGCCTCAACTGGGACCGCGCCGACTGCACCGCTCTGGTCCGCGCCGCCTGGTCCATGGTGACGG
CCCGTAGCATGGGTTCCGACGAGATCTCGTTCGGCGCCGTCGTCGGCAGCCAAGACGCCCCGGCCGTGGTGCCCG
TCCGCGTTCAGCTGGACTGGGAGGCCGGCACGGAAAAGCTCCTTGGAGACATCCGGAGCCAAGCCGCCGTCATGG
CAACCTACCAGCACACAGGTCTGGCACGTATCCGCTGCATGAGCGACGAGGCTGCTTTGGCCTGCGACTTCAAGA
CGCTGCTTGTCATCCGCTCCGCCGAGGAGCAGGTCGAGTCGAACCGTGACGGTTCACACGCCATGCTAGTCGAGG
TCGAGACTCGCAACGCCGACGATGCACGCGTCTGCATCACCTTCGACTCCCACAGCATCAGTGAGGCTCGCGTCT
CGCGCGTCACCCACCAGTTTCAGCACGTCCTTCGCCAGCTCGCCGGCCCGGCCAAGGCCAGACTGCGCGACATCA
CTGTCGTGAGCCAGCGCGACCTCGACGACATTTGGACTTGGAATGCTACCGTTCCCGCCTTGGTTGAGGGTTGTC
TTCACGACCTGATTGAACAGCGTGCTCGCGAGCAGCCCCTGGCTCCGGCCATCGACGCCTGGGACGGCAGCCTGA
CGTACGGCCAGCTGAGCGAGCTCTCGACGCGATTGGCCCACCAGCTAGTCGGCCAAGGCGTTCAACAAGGATGCG
TTGTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTTGCGGCGTTGGCCGTCATGAAGGCCGGCGGTGCCT
CCGTGGCCGTCGATTCGACCCAGCCCGAGGAGCGTATCCGTGTTATTGCCACGCAGGCACGGTCGGCTGGTCGGC
TCGTCGTTGTTTGCTCCATCGCCAATGAGGCTCTCGTTCGGCGGCTGGAGCCCGACGCCCTCGTCAGCATTGGTC
TCGATCGACTTCCGGAATCCCTCCCGGAGCGTTATCCCGTGCTTCCAACCGTTAGCCCGACTGACGTCCTCTACA
TCGTCTTCACCTCGGGCAGTACGGGTCGGCCCAAGGGCGCCATCGTCTCTCACCAGAACTTCTATAGCGCCGTCG
TGTACCAACGAGACGATCTTGGCTACCGCAGCAATAGCCGCGTCTTCGACTTTGCATCGTATGCCTTCGATATCG
CTTGGTCAAACCTGCTTAATACGCTCACGGCGGGAGCTTGCCTATGTATTCCATCAGCGGCGGAACGCGAGAACA
ACCTACCTGGCAGTCTCGAGAAGTATAGAGTCACTGTCGCCGATCTCACACCTTCGGTAGCCCGCTTTATCGAGC
CCAAGTCGTCGCTATCAAACCTCTCGACGCTCCTGCTCGGAGGCGAAGTCGTACTGCCTAGCGACGCGCTCATCG
TGCCCGATCACACTCTCGTCGTTAGCGCCTACGGACCGGCCGAATGCACGCCTACGAGTACTATCCTGCACCTCA
AGAGTTCGAGCGAAATGGGCATCGGCCGCGCCGCAGGTCTCTGCACCTGGGTCGTCGACATGGACAACCCCGAGG
CGCTGGCCCCGATTGGAGCCATCGGCGAGCTGTGGCTCGAGGGCCCGCTTGTCGGTTTAGGCTACCTCGACGAGC
CGGAAAAGACGGCAGCCGCCTTTATTCAGGATCCAGAGTGGCTTGTGCGCGGAGCTCCTGGCACGCGAGAGGGCC
GTCGAGGATCCGTCTACCGCACAGGAGATCTGGTCCAGTACAAAGAGGACGGAACTCTTCTCTTCGTTGGCCGAA
AGGATACTCAAGTCAAGATCAGGGGCCAGCGCGTGGAGCTGGGCGAGGTTGAGCACCACGTGCTGCGGGCCATCA
AGGCAGCCGAACCGGCAGCCAGCTTCCAGATTATCGCCGAGACGATTCAGCCCAAGGGCGCCGACTCAAAGACGC
TGGTTGCCTTTGTGGCCCTCGACGGCGCAAAGGACATGACGCCTGACGAGTACGACGACAAGGTCCGACAGGCGA
CGGCCGGCCTTAACGACCGACTGGCCGAGACTCTACCCGTCTTCATGCTTCCCACAGCCTATGTCCCTCTTCAGA
CGGTGCCCATGATGGCCACCGGCAAGGCCGACCGCCGACAGCTGCGAGCCATCGGGTCGTCGCTCTCGACCAGAG
ATATCGCCCGCCTCAGCCGCGTCGAGGGAGACCGTCGGCCTCCGCGGACCGATTCCGAGCGCACTATGCAGGCGT
TATGGGCTGAGGTGCTAAAGGTTGATCCGGAGAGCATTGGAATCGATGATAGCTTCTTCCGCATCGGCGGTGATT
CCATCGGTGCCATGCGCCTCGTCGGTATCGCTCGTCAGCAAGGTCTTGGTCTGTCCGTCCGAGACATTTTCCAGA
ATCCAGTACTTCGCGACCTCGCAGCCGTCGAGAACCATTCGAGCGTTCCGAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail