Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5811
Gene name
Locationscaffold_488:7827..8642
Strand-
Gene length (bp)815
Transcript length (bp)756
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 1.1E-04 197 225

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5033 0.6645 0.0202 0.1217 0.2452 0.0128 0.2355 0.2904 0.1642 0.05

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2447
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6922
Ophiocordyceps australis map64 (Brazil) OphauB2|780
Ophiocordyceps camponoti-floridani Ophcf2|04504
Ophiocordyceps camponoti-rufipedis Ophun1|5646
Ophiocordyceps kimflemingae Ophio5|5811 (this protein)
Ophiocordyceps subramaniannii Hirsu2|35

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5811
MDSCCTCATLLPSLIVSPTDGRRLQCCARFVCATCLQSNKRFATCCPYCQVSTAPSSLPQGLRDPPTYTSVPSTR
TMTAAVAVPPPPPYSPSPTTKSVETAPKAAKEKEASEDVLHFLDHNQDTISALSLRYRVPASVLRRANNITSDHL
LLGRKTILIPGEYCTTGVSMSPCPVLGEEEELRKSRIRRFMISCKVADYDVALLYLEQSDYHLDAAIDSYLDDES
WERDHPRPQSGDRKRQKGRLRPWLGL
Coding >Ophio5|5811
ATGGACTCTTGCTGCACCTGCGCCACTCTTCTTCCCTCGCTCATCGTCTCTCCTACCGATGGCCGAAGGCTACAG
TGTTGCGCCAGATTCGTCTGCGCAACATGCTTACAGAGCAACAAGCGATTTGCTACCTGTTGCCCCTATTGCCAA
GTGTCCACCGCGCCGTCGTCTCTGCCGCAGGGACTCAGAGACCCTCCGACATACACGTCCGTTCCGTCCACGCGA
ACCATGACCGCAGCCGTCGCCGTTCCTCCGCCGCCCCCGTACTCCCCGTCTCCCACAACCAAGTCTGTCGAGACG
GCACCCAAAGCCGCAAAAGAAAAGGAAGCATCCGAGGACGTCCTCCACTTCCTTGATCACAACCAAGACACTATC
TCCGCGCTCTCCCTCCGCTATCGCGTTCCGGCCTCTGTCCTGAGACGGGCCAATAACATCACAAGCGACCACCTC
CTCCTTGGACGCAAGACCATCCTGATCCCCGGCGAATATTGTACGACTGGTGTCAGCATGTCGCCGTGTCCGGTC
CTGGGCGAGGAGGAGGAGCTGAGAAAGAGCAGGATTCGTCGCTTCATGATATCCTGCAAGGTGGCCGACTATGAC
GTCGCCCTGCTCTACCTCGAGCAGTCCGACTATCACCTGGATGCCGCCATAGACTCGTACCTCGACGACGAATCC
TGGGAGAGAGACCATCCCCGACCACAGTCAGGCGACAGGAAACGACAAAAGGGACGCCTTCGTCCATGGCTAGGC
CTG
Transcript >Ophio5|5811
ATGGACTCTTGCTGCACCTGCGCCACTCTTCTTCCCTCGCTCATCGTCTCTCCTACCGATGGCCGAAGGCTACAG
TGTTGCGCCAGATTCGTCTGCGCAACATGCTTACAGAGCAACAAGCGATTTGCTACCTGTTGCCCCTATTGCCAA
GTGTCCACCGCGCCGTCGTCTCTGCCGCAGGGACTCAGAGACCCTCCGACATACACGTCCGTTCCGTCCACGCGA
ACCATGACCGCAGCCGTCGCCGTTCCTCCGCCGCCCCCGTACTCCCCGTCTCCCACAACCAAGTCTGTCGAGACG
GCACCCAAAGCCGCAAAAGAAAAGGAAGCATCCGAGGACGTCCTCCACTTCCTTGATCACAACCAAGACACTATC
TCCGCGCTCTCCCTCCGCTATCGCGTTCCGGCCTCTGTCCTGAGACGGGCCAATAACATCACAAGCGACCACCTC
CTCCTTGGACGCAAGACCATCCTGATCCCCGGCGAATATTGTACGACTGGTGTCAGCATGTCGCCGTGTCCGGTC
CTGGGCGAGGAGGAGGAGCTGAGAAAGAGCAGGATTCGTCGCTTCATGATATCCTGCAAGGTGGCCGACTATGAC
GTCGCCCTGCTCTACCTCGAGCAGTCCGACTATCACCTGGATGCCGCCATAGACTCGTACCTCGACGACGAATCC
TGGGAGAGAGACCATCCCCGACCACAGTCAGGCGACAGGAAACGACAAAAGGGACGCCTTCGTCCATGGCTAGGC
CTGTGA
Gene >Ophio5|5811
ATGGACTCTTGCTGCACCTGCGCCACTCTTCTTCCCTCGCTCATCGTCTCTCCTACCGATGGCCGAAGGCTACAG
TGTTGCGCCAGATTCGTCTGCGCAACATGCTTACAGGTCCGTCGCAGCTGCCGGACACCCCCCAAAGTCTTCCCC
TCGTTGACGGCCCAGTGCAGAGCAACAAGCGATTTGCTACCTGTTGCCCCTATTGCCAAGTGTCCACCGCGCCGT
CGTCTCTGCCGCAGGGACTCAGAGACCCTCCGACATACACGTCCGTTCCGTCCACGCGAACCATGACCGCAGCCG
TCGCCGTTCCTCCGCCGCCCCCGTACTCCCCGTCTCCCACAACCAAGTCTGTCGAGACGGCACCCAAAGCCGCAA
AAGAAAAGGAAGCATCCGAGGACGTCCTCCACTTCCTTGATCACAACCAAGACACTATCTCCGCGCTCTCCCTCC
GCTATCGCGTTCCGGCCTCTGTCCTGAGACGGGCCAATAACATCACAAGCGACCACCTCCTCCTTGGACGCAAGA
CCATCCTGATCCCCGGCGAATATTGTACGACTGGTGTCAGCATGTCGCCGTGTCCGGTCCTGGGCGAGGAGGAGG
AGCTGAGAAAGAGCAGGATTCGTCGCTTCATGATATCCTGCAAGGTGGCCGACTATGACGTCGCCCTGCTCTACC
TCGAGCAGTCCGACTATCACCTGGATGCCGCCATAGACTCGTACCTCGACGACGAATCCTGGGAGAGAGACCATC
CCCGACCACAGTCAGGCGACAGGAAACGACAAAAGGGACGCCTTCGTCCATGGCTAGGCCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail