Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5810
Gene name
Locationscaffold_488:3589..7658
Strand+
Gene length (bp)4069
Transcript length (bp)3666
Coding sequence length (bp)3663
Protein length (aa) 1221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 2.6E-136 82 618
PF03178 CPSF_A CPSF A subunit region 3.4E-94 865 1186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR22|RSE1_CRYNJ Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RSE1 PE=3 SV=1 9 1221 0.0E+00
sp|Q52E49|RSE1_MAGO7 Pre-mRNA-splicing factor RSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RSE1 PE=3 SV=2 1 1221 0.0E+00
sp|Q5A7S5|RSE1_CANAL Pre-mRNA-splicing factor RSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RSE1 PE=3 SV=1 8 1221 0.0E+00
sp|Q6BYK1|RSE1_DEBHA Pre-mRNA-splicing factor RSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RSE1 PE=3 SV=2 8 1221 0.0E+00
sp|Q54SA7|SF3B3_DICDI Probable splicing factor 3B subunit 3 OS=Dictyostelium discoideum GN=sf3b3 PE=3 SV=1 8 1218 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR22|RSE1_CRYNJ Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RSE1 PE=3 SV=1 9 1221 0.0E+00
sp|Q52E49|RSE1_MAGO7 Pre-mRNA-splicing factor RSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RSE1 PE=3 SV=2 1 1221 0.0E+00
sp|Q5A7S5|RSE1_CANAL Pre-mRNA-splicing factor RSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RSE1 PE=3 SV=1 8 1221 0.0E+00
sp|Q6BYK1|RSE1_DEBHA Pre-mRNA-splicing factor RSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RSE1 PE=3 SV=2 8 1221 0.0E+00
sp|Q54SA7|SF3B3_DICDI Probable splicing factor 3B subunit 3 OS=Dictyostelium discoideum GN=sf3b3 PE=3 SV=1 8 1218 0.0E+00
sp|Q9UTT2|RSE1_SCHPO Pre-mRNA-splicing factor prp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp12 PE=1 SV=1 1 1219 0.0E+00
sp|P0CR23|RSE1_CRYNB Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RSE1 PE=3 SV=1 9 1221 0.0E+00
sp|Q1LVE8|SF3B3_DANRE Splicing factor 3B subunit 3 OS=Danio rerio GN=sf3b3 PE=2 SV=1 8 1221 0.0E+00
sp|Q5RBI5|SF3B3_PONAB Splicing factor 3B subunit 3 OS=Pongo abelii GN=SF3B3 PE=2 SV=1 8 1221 0.0E+00
sp|Q921M3|SF3B3_MOUSE Splicing factor 3B subunit 3 OS=Mus musculus GN=Sf3b3 PE=1 SV=1 8 1221 0.0E+00
sp|A0JN52|SF3B3_BOVIN Splicing factor 3B subunit 3 OS=Bos taurus GN=SF3B3 PE=2 SV=1 8 1221 0.0E+00
sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 8 1221 0.0E+00
sp|Q4PGM6|RSE1_USTMA Pre-mRNA-splicing factor RSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RSE1 PE=3 SV=1 8 1216 0.0E+00
sp|Q4WLI5|RSE1_ASPFU Pre-mRNA-splicing factor rse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rse1 PE=3 SV=1 1 1213 0.0E+00
sp|Q5B1X8|RSE1_EMENI Pre-mRNA-splicing factor rse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rse1 PE=3 SV=2 1 1221 0.0E+00
sp|Q7RYR4|RSE1_NEUCR Pre-mRNA-splicing factor rse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-5 PE=3 SV=2 1 1221 0.0E+00
sp|Q6CAH5|RSE1_YARLI Pre-mRNA-splicing factor RSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RSE1 PE=3 SV=1 5 1200 1.0E-165
sp|Q753D4|RSE1_ASHGO Pre-mRNA-splicing factor RSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RSE1 PE=3 SV=2 9 1217 2.0E-125
sp|Q04693|RSE1_YEAST Pre-mRNA-splicing factor RSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSE1 PE=1 SV=1 8 719 3.0E-59
sp|Q6CXH8|RSE1_KLULA Pre-mRNA-splicing factor RSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RSE1 PE=3 SV=1 1 719 3.0E-53
sp|Q9XYZ5|DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster GN=pic PE=1 SV=1 10 1216 5.0E-49
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 10 1215 6.0E-49
sp|Q6P6Z0|DDB1_XENLA DNA damage-binding protein 1 OS=Xenopus laevis GN=ddb1 PE=2 SV=1 10 1201 1.0E-48
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 10 1215 2.0E-47
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 10 1215 3.0E-47
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 10 1215 1.0E-46
sp|Q5R649|DDB1_PONAB DNA damage-binding protein 1 OS=Pongo abelii GN=DDB1 PE=2 SV=1 10 1201 4.0E-45
sp|Q805F9|DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus GN=DDB1 PE=1 SV=1 10 1201 4.0E-45
sp|Q16531|DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens GN=DDB1 PE=1 SV=1 10 1201 8.0E-45
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 10 1201 2.0E-44
sp|A1A4K3|DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus GN=DDB1 PE=1 SV=1 10 1201 3.0E-44
sp|P33194|DDB1_CHLAE DNA damage-binding protein 1 OS=Chlorocebus aethiops GN=DDB1 PE=1 SV=1 10 1201 4.0E-44
sp|Q9ESW0|DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus GN=Ddb1 PE=1 SV=1 10 1201 2.0E-42
sp|Q04693|RSE1_YEAST Pre-mRNA-splicing factor RSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSE1 PE=1 SV=1 892 1217 2.0E-34
sp|Q6CXH8|RSE1_KLULA Pre-mRNA-splicing factor RSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RSE1 PE=3 SV=1 933 1201 2.0E-29
sp|Q6FLQ6|RSE1_CANGA Pre-mRNA-splicing factor RSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RSE1 PE=3 SV=1 296 718 3.0E-27
sp|Q21554|DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans GN=ddb-1 PE=1 SV=2 246 1214 8.0E-27
sp|B0M0P5|DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum GN=repE PE=1 SV=1 234 1216 7.0E-16
sp|Q6FLQ6|RSE1_CANGA Pre-mRNA-splicing factor RSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RSE1 PE=3 SV=1 940 1166 3.0E-13
sp|Q9FGR0|CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana GN=CPSF160 PE=1 SV=2 769 1221 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.536 0.5296 0.0174 0.1398 0.0673 0.0103 0.2275 0.4863 0.4085 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6924
Ophiocordyceps australis map64 (Brazil) OphauB2|781
Ophiocordyceps camponoti-floridani Ophcf2|04505
Ophiocordyceps camponoti-rufipedis Ophun1|5645
Ophiocordyceps kimflemingae Ophio5|5810 (this protein)
Ophiocordyceps subramaniannii Hirsu2|36

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5810
MATTSNQFLYSLTIQPPSHIVYAALGQFGGTREQLIITASGSILTLLRPDPNLGKVHAVLVHDVFGIIRALASFR
VTGSSKDFLIIASDSGRVTIVEYLPASNRFSRVHMETYGKSGIRRVIPGEFLVCDPKGRAFLVASLEKNKIVYVL
NRIAGATTEDNLAAELTISSPLEAHKPGVLVICMVALDVGYSNPVFAALEIDCSEVDQDATGDALQEIQTQLVYY
ELDLGLNHVVRKWSDIVDPTSSILFQVPGGGDGPSGVLVCGRESITYMHSNQEALRVAIPRRKGALEDPSRKRSI
VSGIMHKLKGSTGAFFFLLQTEDGDIFRVTMDMIKNEAGKPTGDVKRLVIKYFDTVPVATSFCILKNGFLFVASQ
HGDPGFYQFEKLGDDDNEQEYNSDQFPVDSRAPYDPVYFNPRPADNITLFQSVPSMNPLMDCKVANLTGEDAPQI
YTACGSGARSSFRMLKHGLDVTHIVGSQLPGTPSAVWTLKLNRRDVFDAFLVLSFSNGSLILSIGETVEQVDDSG
FFTEFPTLAAQLLGDGGLLQVHPKGIRVVRNGQPDDWEAPQHRSIVAAATNAQQVAIALSSGEIIYFEADEEGNL
NEFEDRKAMSGTVTCLSLGDIPEGRLRSSFLAVGCDDCTVRILSLDHGSTLDNKSVQALTAAPTSLAIMTMDDSS
SGGSTLYLHIGLHSGIYLRTVLDEISGELTDTRQKFLGPKQVRLFQLTVEGKTCVLALSSRPWLGYPDPITKSYV
MAPLNYPELVWGWNFTSPQCKQGLVTIHEQDLSILSIDRLGDALTQKSIPLTYTPRKLVKHPEQPLFYTIESDNN
TLPINVREQLLADPASVNGDAATTLPPEIFGHPKGNRHWASCISVIDPMAEEPQVLQTFHLDQNESAVSAAVVPF
AAQYGENFLVVGVGKDVVINPRRFSEASIHVYRFNDNGREIELVHKTPVEELPLALLAFQGRVLVGIGKVLRAYD
LGMRQLLRKSHAEVSPQQIVSLSTQGNRIIVGDVHQGITYVTYKQSTNKLIPFADDIIQRWTTCTTMVDYESVAG
GDKFGNLFLVRCPPKVSQEADEEDSGIHLVNARSYMHGCAWRHDLVCHFYTNDIPTSVTKTSLVVGGQDVLLWSG
LMGTIGVLIPLVSREDADFFQSLEQHLRSEDPPLAGRDHLIYRGYYAPVKGVIDGDLCERYNLLSQEKKAMIAGE
LDRSVREIERKISDVRTRSAF
Coding >Ophio5|5810
ATGGCTACTACTTCGAACCAGTTCCTTTACTCGCTGACGATCCAGCCGCCAAGTCACATCGTTTACGCGGCTCTG
GGGCAGTTTGGGGGCACTCGAGAGCAGCTCATCATCACCGCTTCAGGCTCGATTTTGACGCTGCTGCGCCCAGAC
CCCAACCTCGGCAAGGTTCATGCAGTTCTTGTGCACGATGTCTTCGGCATCATCCGAGCGCTCGCCTCCTTCCGT
GTCACCGGCAGTAGCAAAGACTTTCTCATCATCGCGTCCGACTCGGGCCGTGTGACCATCGTTGAATACCTGCCC
GCCAGCAACCGCTTCTCTCGCGTGCACATGGAGACGTACGGCAAGTCTGGCATTCGAAGAGTGATTCCGGGCGAG
TTCCTTGTTTGCGATCCCAAAGGACGAGCCTTCCTAGTCGCTTCGTTGGAGAAGAACAAGATTGTCTACGTTCTC
AACCGCATCGCGGGGGCCACCACAGAAGACAATCTGGCGGCCGAGCTCACCATCTCTTCCCCCCTCGAAGCTCAC
AAGCCCGGTGTACTGGTCATTTGCATGGTGGCTCTTGACGTGGGATATTCTAATCCCGTATTCGCCGCTCTGGAG
ATTGACTGCTCTGAAGTCGATCAAGACGCGACAGGAGACGCGCTCCAGGAGATCCAGACCCAGCTGGTGTACTAC
GAACTTGATCTTGGGCTGAATCACGTTGTCCGCAAGTGGTCAGACATCGTCGATCCGACGTCCTCCATCCTCTTC
CAGGTCCCAGGCGGCGGTGACGGTCCCAGTGGCGTCCTGGTCTGTGGACGTGAGAGCATCACCTACATGCACAGC
AATCAAGAGGCCTTGCGCGTGGCGATCCCCCGCCGGAAAGGGGCCCTCGAGGACCCTTCCAGGAAAAGAAGCATC
GTCTCCGGCATCATGCATAAGCTCAAGGGCAGTACTGGCGCCTTCTTCTTCCTCCTTCAGACTGAGGACGGCGAC
ATATTCCGAGTCACAATGGATATGATCAAGAACGAGGCAGGGAAGCCTACAGGGGACGTTAAACGGCTCGTCATT
AAGTATTTCGACACTGTCCCTGTGGCGACCAGCTTCTGCATCCTCAAGAACGGCTTCCTCTTCGTTGCCAGCCAG
CACGGTGACCCCGGCTTCTACCAGTTCGAGAAGCTTGGTGACGACGACAATGAGCAGGAGTACAACAGCGATCAG
TTCCCTGTAGATTCACGGGCACCGTACGATCCCGTTTACTTCAACCCTCGGCCGGCGGATAACATCACATTGTTC
CAGAGCGTTCCGTCTATGAACCCCCTCATGGACTGCAAGGTCGCCAATTTGACCGGAGAAGACGCACCGCAGATT
TACACGGCTTGCGGCAGCGGTGCGCGGAGCTCATTTCGAATGCTGAAGCATGGACTCGACGTCACCCATATCGTC
GGGTCTCAGCTGCCTGGAACGCCGTCGGCCGTATGGACGCTCAAGCTGAATCGTCGGGACGTCTTCGACGCGTTC
CTCGTCCTGTCTTTCAGCAACGGATCGCTCATCCTGAGCATAGGAGAAACGGTGGAGCAGGTGGACGACTCGGGC
TTCTTCACCGAGTTTCCCACCCTCGCTGCACAGCTCCTCGGCGACGGTGGGCTGCTCCAGGTTCACCCCAAGGGA
ATTCGAGTGGTGCGGAACGGGCAGCCCGATGATTGGGAGGCCCCTCAACATCGCTCTATTGTGGCGGCCGCGACC
AATGCCCAGCAGGTCGCCATTGCCCTGAGCTCCGGCGAGATCATCTATTTCGAGGCCGATGAAGAGGGCAATCTC
AACGAATTCGAGGACAGAAAGGCCATGTCGGGGACGGTCACTTGCCTGAGCTTGGGCGACATTCCCGAGGGAAGG
CTTCGCAGCTCCTTTCTCGCCGTCGGTTGCGACGACTGTACCGTGCGCATACTTAGTTTGGATCACGGCTCAACG
CTCGACAACAAGTCGGTTCAGGCATTGACGGCCGCACCCACATCGTTGGCCATCATGACAATGGACGACTCGTCC
TCGGGCGGCTCGACGCTTTATCTGCACATCGGACTGCACTCGGGCATCTACCTGCGCACGGTCCTGGATGAGATA
TCGGGCGAACTCACCGACACCCGCCAGAAGTTCTTGGGCCCCAAGCAAGTCAGGCTTTTTCAGCTTACCGTCGAG
GGCAAGACCTGTGTTCTGGCCCTGAGCTCCCGCCCCTGGCTCGGCTACCCCGACCCGATCACCAAAAGCTACGTG
ATGGCGCCTTTGAACTATCCGGAGCTGGTGTGGGGCTGGAACTTTACGAGCCCGCAGTGCAAGCAGGGCCTGGTG
ACGATTCACGAGCAAGACTTGAGTATTCTGTCAATCGACAGGCTGGGAGACGCCCTCACCCAGAAGTCTATCCCT
CTCACCTACACGCCCAGGAAGCTCGTCAAGCATCCAGAGCAGCCTCTGTTTTACACCATTGAATCCGACAACAAC
ACGCTTCCGATCAACGTCCGAGAGCAGTTGCTCGCTGACCCCGCTTCGGTCAATGGCGATGCTGCGACGACGCTC
CCTCCGGAGATCTTTGGCCACCCCAAAGGTAACCGTCATTGGGCATCGTGCATCAGTGTCATCGACCCAATGGCC
GAGGAGCCGCAAGTGTTGCAGACGTTTCATCTGGACCAGAATGAGTCTGCCGTCAGCGCCGCCGTGGTTCCCTTT
GCCGCACAATATGGGGAGAACTTTCTGGTCGTCGGTGTCGGCAAGGACGTTGTCATCAACCCTCGACGATTTTCC
GAGGCTTCCATTCACGTCTATCGTTTCAACGATAACGGTCGCGAGATCGAGCTGGTTCACAAAACGCCAGTCGAG
GAGTTGCCGCTTGCCTTGTTGGCCTTTCAAGGGAGGGTTCTAGTCGGAATCGGCAAGGTCTTGCGCGCATACGAC
CTCGGGATGCGACAGCTGTTGCGGAAGTCCCATGCTGAGGTGTCGCCTCAACAAATCGTGTCCCTCAGCACCCAG
GGCAACCGCATTATCGTGGGCGACGTCCACCAGGGCATCACCTATGTCACCTACAAGCAGTCGACGAACAAGCTG
ATACCTTTCGCCGACGACATCATCCAGCGATGGACGACGTGCACGACCATGGTCGACTACGAGTCCGTTGCCGGC
GGTGATAAGTTCGGAAACCTCTTCCTCGTGCGTTGCCCTCCGAAAGTGAGCCAAGAGGCAGACGAGGAGGATTCG
GGCATCCACTTGGTAAACGCGAGGTCTTATATGCACGGATGCGCGTGGCGACACGACCTTGTGTGCCACTTTTAC
ACCAATGACATTCCCACCAGCGTCACCAAGACCAGCCTCGTCGTTGGAGGCCAGGACGTGTTGCTGTGGAGTGGA
CTCATGGGGACCATCGGTGTACTCATCCCCCTCGTGAGCAGGGAGGATGCCGACTTCTTCCAGAGCCTGGAGCAG
CACCTCCGCAGCGAGGACCCGCCGTTGGCCGGACGAGATCACCTTATCTACCGCGGTTACTACGCCCCGGTGAAA
GGCGTCATTGACGGCGACCTCTGCGAGCGGTACAACCTGCTCAGCCAGGAAAAGAAGGCCATGATTGCGGGGGAA
CTGGACCGATCTGTTCGGGAGATTGAAAGGAAAATCTCGGATGTCCGGACTCGATCTGCTTTC
Transcript >Ophio5|5810
ATGGCTACTACTTCGAACCAGTTCCTTTACTCGCTGACGATCCAGCCGCCAAGTCACATCGTTTACGCGGCTCTG
GGGCAGTTTGGGGGCACTCGAGAGCAGCTCATCATCACCGCTTCAGGCTCGATTTTGACGCTGCTGCGCCCAGAC
CCCAACCTCGGCAAGGTTCATGCAGTTCTTGTGCACGATGTCTTCGGCATCATCCGAGCGCTCGCCTCCTTCCGT
GTCACCGGCAGTAGCAAAGACTTTCTCATCATCGCGTCCGACTCGGGCCGTGTGACCATCGTTGAATACCTGCCC
GCCAGCAACCGCTTCTCTCGCGTGCACATGGAGACGTACGGCAAGTCTGGCATTCGAAGAGTGATTCCGGGCGAG
TTCCTTGTTTGCGATCCCAAAGGACGAGCCTTCCTAGTCGCTTCGTTGGAGAAGAACAAGATTGTCTACGTTCTC
AACCGCATCGCGGGGGCCACCACAGAAGACAATCTGGCGGCCGAGCTCACCATCTCTTCCCCCCTCGAAGCTCAC
AAGCCCGGTGTACTGGTCATTTGCATGGTGGCTCTTGACGTGGGATATTCTAATCCCGTATTCGCCGCTCTGGAG
ATTGACTGCTCTGAAGTCGATCAAGACGCGACAGGAGACGCGCTCCAGGAGATCCAGACCCAGCTGGTGTACTAC
GAACTTGATCTTGGGCTGAATCACGTTGTCCGCAAGTGGTCAGACATCGTCGATCCGACGTCCTCCATCCTCTTC
CAGGTCCCAGGCGGCGGTGACGGTCCCAGTGGCGTCCTGGTCTGTGGACGTGAGAGCATCACCTACATGCACAGC
AATCAAGAGGCCTTGCGCGTGGCGATCCCCCGCCGGAAAGGGGCCCTCGAGGACCCTTCCAGGAAAAGAAGCATC
GTCTCCGGCATCATGCATAAGCTCAAGGGCAGTACTGGCGCCTTCTTCTTCCTCCTTCAGACTGAGGACGGCGAC
ATATTCCGAGTCACAATGGATATGATCAAGAACGAGGCAGGGAAGCCTACAGGGGACGTTAAACGGCTCGTCATT
AAGTATTTCGACACTGTCCCTGTGGCGACCAGCTTCTGCATCCTCAAGAACGGCTTCCTCTTCGTTGCCAGCCAG
CACGGTGACCCCGGCTTCTACCAGTTCGAGAAGCTTGGTGACGACGACAATGAGCAGGAGTACAACAGCGATCAG
TTCCCTGTAGATTCACGGGCACCGTACGATCCCGTTTACTTCAACCCTCGGCCGGCGGATAACATCACATTGTTC
CAGAGCGTTCCGTCTATGAACCCCCTCATGGACTGCAAGGTCGCCAATTTGACCGGAGAAGACGCACCGCAGATT
TACACGGCTTGCGGCAGCGGTGCGCGGAGCTCATTTCGAATGCTGAAGCATGGACTCGACGTCACCCATATCGTC
GGGTCTCAGCTGCCTGGAACGCCGTCGGCCGTATGGACGCTCAAGCTGAATCGTCGGGACGTCTTCGACGCGTTC
CTCGTCCTGTCTTTCAGCAACGGATCGCTCATCCTGAGCATAGGAGAAACGGTGGAGCAGGTGGACGACTCGGGC
TTCTTCACCGAGTTTCCCACCCTCGCTGCACAGCTCCTCGGCGACGGTGGGCTGCTCCAGGTTCACCCCAAGGGA
ATTCGAGTGGTGCGGAACGGGCAGCCCGATGATTGGGAGGCCCCTCAACATCGCTCTATTGTGGCGGCCGCGACC
AATGCCCAGCAGGTCGCCATTGCCCTGAGCTCCGGCGAGATCATCTATTTCGAGGCCGATGAAGAGGGCAATCTC
AACGAATTCGAGGACAGAAAGGCCATGTCGGGGACGGTCACTTGCCTGAGCTTGGGCGACATTCCCGAGGGAAGG
CTTCGCAGCTCCTTTCTCGCCGTCGGTTGCGACGACTGTACCGTGCGCATACTTAGTTTGGATCACGGCTCAACG
CTCGACAACAAGTCGGTTCAGGCATTGACGGCCGCACCCACATCGTTGGCCATCATGACAATGGACGACTCGTCC
TCGGGCGGCTCGACGCTTTATCTGCACATCGGACTGCACTCGGGCATCTACCTGCGCACGGTCCTGGATGAGATA
TCGGGCGAACTCACCGACACCCGCCAGAAGTTCTTGGGCCCCAAGCAAGTCAGGCTTTTTCAGCTTACCGTCGAG
GGCAAGACCTGTGTTCTGGCCCTGAGCTCCCGCCCCTGGCTCGGCTACCCCGACCCGATCACCAAAAGCTACGTG
ATGGCGCCTTTGAACTATCCGGAGCTGGTGTGGGGCTGGAACTTTACGAGCCCGCAGTGCAAGCAGGGCCTGGTG
ACGATTCACGAGCAAGACTTGAGTATTCTGTCAATCGACAGGCTGGGAGACGCCCTCACCCAGAAGTCTATCCCT
CTCACCTACACGCCCAGGAAGCTCGTCAAGCATCCAGAGCAGCCTCTGTTTTACACCATTGAATCCGACAACAAC
ACGCTTCCGATCAACGTCCGAGAGCAGTTGCTCGCTGACCCCGCTTCGGTCAATGGCGATGCTGCGACGACGCTC
CCTCCGGAGATCTTTGGCCACCCCAAAGGTAACCGTCATTGGGCATCGTGCATCAGTGTCATCGACCCAATGGCC
GAGGAGCCGCAAGTGTTGCAGACGTTTCATCTGGACCAGAATGAGTCTGCCGTCAGCGCCGCCGTGGTTCCCTTT
GCCGCACAATATGGGGAGAACTTTCTGGTCGTCGGTGTCGGCAAGGACGTTGTCATCAACCCTCGACGATTTTCC
GAGGCTTCCATTCACGTCTATCGTTTCAACGATAACGGTCGCGAGATCGAGCTGGTTCACAAAACGCCAGTCGAG
GAGTTGCCGCTTGCCTTGTTGGCCTTTCAAGGGAGGGTTCTAGTCGGAATCGGCAAGGTCTTGCGCGCATACGAC
CTCGGGATGCGACAGCTGTTGCGGAAGTCCCATGCTGAGGTGTCGCCTCAACAAATCGTGTCCCTCAGCACCCAG
GGCAACCGCATTATCGTGGGCGACGTCCACCAGGGCATCACCTATGTCACCTACAAGCAGTCGACGAACAAGCTG
ATACCTTTCGCCGACGACATCATCCAGCGATGGACGACGTGCACGACCATGGTCGACTACGAGTCCGTTGCCGGC
GGTGATAAGTTCGGAAACCTCTTCCTCGTGCGTTGCCCTCCGAAAGTGAGCCAAGAGGCAGACGAGGAGGATTCG
GGCATCCACTTGGTAAACGCGAGGTCTTATATGCACGGATGCGCGTGGCGACACGACCTTGTGTGCCACTTTTAC
ACCAATGACATTCCCACCAGCGTCACCAAGACCAGCCTCGTCGTTGGAGGCCAGGACGTGTTGCTGTGGAGTGGA
CTCATGGGGACCATCGGTGTACTCATCCCCCTCGTGAGCAGGGAGGATGCCGACTTCTTCCAGAGCCTGGAGCAG
CACCTCCGCAGCGAGGACCCGCCGTTGGCCGGACGAGATCACCTTATCTACCGCGGTTACTACGCCCCGGTGAAA
GGCGTCATTGACGGCGACCTCTGCGAGCGGTACAACCTGCTCAGCCAGGAAAAGAAGGCCATGATTGCGGGGGAA
CTGGACCGATCTGTTCGGGAGATTGAAAGGAAAATCTCGGATGTCCGGACTCGATCTGCTTTCTAA
Gene >Ophio5|5810
ATGGCTACTACTTCGAACCAGTTCCTTTACTCGCTGACGATCCAGCCGCCAAGTCACATCGTTTACGCGGCTCTG
GGGCAGTTTGGGGGCACTCGAGAGCAGCTCATCATCACCGCTTCAGGCTCGATTTTGACGCTGCTGCGCCCAGAC
CCCAACCTCGGCAAGGTTCATGCAGTTCTTGTGCACGATGTCTTCGGCATCATCCGAGCGCTCGCCTCCTTCCGT
GTCACCGGCAGTAGCAAAGGTGCCTGCTTTTCTTTTCCCCCCAAAACTTCCACAACTCGACCTGACACGAGCGTT
CGGAAACCACTCGTCACCTCGGCGAAAGAAACTTTCTGCCACAAAATGCGAGTAGCAACTGACATCTCATCACCC
AGACTTTCTCATCATCGCGTCCGACTCGGGCCGTGTGACCATCGTTGAATACCTGCCCGCCAGCAACCGCTTCTC
TCGCGTGCACATGGAGACGTACGGCAAGTCTGGCATTCGAAGAGTGATTCCGGGCGAGTTCCTTGTTTGCGATCC
CAAAGGACGAGCCTTCCTAGTCGCTTCGTTGGAGAAGAACAAGATTGTCTACGTTCTCAACCGCATCGCGGGGGC
CACCACAGAAGACAATCTGGCGGCCGAGCTCACCATCTCTTCCCCCCTCGAAGCTCACAAGCCCGGTGTACTGGT
CATTTGCATGGTGGCTCTTGACGTGGGATATTCTAATCCCGTATTCGCCGCTCTGGAGATTGACTGCTCTGAAGT
CGATCAAGACGCGACAGGAGACGCGCTCCAGGAGATCCAGACCCAGCTGGTGTACTACGAACTTGATCTTGGGCT
GAATCACGTTGTCCGCAAGTGGTCAGACATCGTCGATCCGACGTCCTCCATCCTCTTCCAGGTCCCAGGCGGCGG
TGACGGTCCCAGTGGCGTCCTGGTCTGTGGACGTGAGAGCATCACCTACATGCACAGCAATCAAGAGGCCTTGCG
CGTGGCGATCCCCCGCCGGAAAGGGGCCCTCGAGGACCCTTCCAGGAAAAGAAGCATCGTCTCCGGCATCATGCA
TAAGCTCAAGGGCAGTACTGGCGCCTTCTTCTTCCTCCTTCAGACTGAGGACGGCGACATATTCCGAGTCACAAT
GGATATGATCAAGAACGAGGCAGGGAAGCCTACAGGGGACGTTAAACGGCTCGTCATTAAGTATTTCGACACTGT
CCCTGTGGCGACCAGCTTCTGCATCCTCAAGAACGGCTTCCTCTTCGTTGCCAGCCAGCACGGTGACCCCGGCTT
CTACCAGTTCGAGAAGCTTGGTGACGACGACAATGAGCAGGAGTACAACAGCGATCAGTTCCCTGTAGATTCACG
GGCACCGTACGATCCCGTTTACTTCAACCCTCGGCCGGCGGATAACATCACATTGTTCCAGAGCGTTCCGTCTAT
GAACCCCCTCATGGACTGCAAGGTCGCCAATTTGACCGGAGAAGACGCACCGCAGATTTACACGGCTTGCGGCAG
CGGTGCGCGGAGCTCATTTCGAATGCTGAAGCATGGACTCGACGTCACCCATATCGTCGGGTCTCAGCTGCCTGG
AACGCCGTCGGCCGTATGGACGCTCAAGCTGAATCGTCGGGACGTCTTCGACGCGTTCCTCGTCCTGTCTTTCAG
CAACGGATCGCTCATCCTGAGCATAGGAGAAACGGTGGAGCAGGTGGACGACTCGGGCTTCTTCACCGAGTTTCC
CACCCTCGCTGCACAGCTCCTCGGCGACGGTGGGCTGCTCCAGGTTCACCCCAAGGGAATTCGAGTGGTGCGGAA
CGGGCAGCCCGATGATTGGGAGGCCCCTCAACATCGCTCTATTGTGGCGGCCGCGACCAATGCCCAGCAGGTCGC
CATTGCCCTGAGCTCCGGCGAGATCATCTATTTCGAGGCCGATGAAGAGGGCAATCTCAACGAATTCGAGGACAG
AAAGGCCATGTCGGGGACGGTCACTTGCCTGAGCTTGGGCGACATTCCCGAGGGAAGGCTTCGCAGCTCCTTTCT
CGCCGTCGGTTGCGACGACTGTACCGTGCGCATACTTAGTTTGGATCACGGCTCAACGCTCGACAACAAGTCGGT
TCAGGCATTGACGGCCGCACCCACATCGTTGGCCATCATGACAATGGACGACTCGTCCTCGGGCGGCTCGACGCT
TTATCTGCACATCGGACTGCACTCGGGCATCTACCTGCGCACGGTCCTGGATGAGATATCGGGCGAACTCACCGA
CACCCGCCAGAAGTTCTTGGGCCCCAAGCAAGTCAGGCTTTTTCAGCTTACCGTCGAGGGCAAGACCTGTGTTCT
GGCCCTGAGCTCCCGCCCCTGGCTCGGCTACCCCGACCCGATCACCAAAAGCTACGTGATGGCGCCTTTGAACTA
TCCGGAGCTGGTGTGGGGCTGGAACTTTACGAGCCCGCAGTGCAAGCAGGGCCTGGTGACGATTCACGAGCAAGA
CTTGAGGTGAGTCGAGTGGCAGGCTCTATACTGCTTTTCCTCGGCCAGGCGTTACGTGATGAAAAGACAAACCCG
ATGCCCCCCCCCCCGGGGGGGCCATGAGGCTTTACACTTCATGTTTATTTTCTCTAATTGTTCCTACTGATGCAC
CAACTTCTTCTTCTGTTTGCTTCTTCATCTCGTCGTCGACCGAATCACTGATCCGGCCACAGTATTCTGTCAATC
GACAGGCTGGGAGACGCCCTCACCCAGAAGTCTATCCCTCTCACCTACACGCCCAGGAAGCTCGTCAAGCATCCA
GAGCAGCCTCTGTTTTACACCATTGAATCCGACAACAACACGCTTCCGATCAACGTCCGAGAGCAGTTGCTCGCT
GACCCCGCTTCGGTCAATGGCGATGCTGCGACGACGCTCCCTCCGGAGATCTTTGGCCACCCCAAAGGTAACCGT
CATTGGGCATCGTGCATCAGTGTCATCGACCCAATGGCCGAGGAGCCGCAAGTGTTGCAGACGTTTCATCTGGAC
CAGAATGAGTCTGCCGTCAGCGCCGCCGTGGTTCCCTTTGCCGCACAATATGGGGAGAACTTTCTGGTCGTCGGT
GTCGGCAAGGACGTTGTCATCAACCCTCGACGATTTTCCGAGGCTTCCATTCACGTCTATCGTTTCAACGATAAC
GGTCGCGAGATCGAGCTGGTTCACAAAACGCCAGTCGAGGAGTTGCCGCTTGCCTTGTTGGCCTTTCAAGGGAGG
GTTCTAGTCGGAATCGGCAAGGTCTTGCGCGCATACGACCTCGGGATGCGACAGCTGTTGCGGAAGTCCCATGCT
GAGGTGTCGCCTCAACAAATCGTGTCCCTCAGCACCCAGGGCAACCGCATTATCGTGGGCGACGTCCACCAGGGC
ATCACCTATGTCACCTACAAGCAGTCGACGAACAAGCTGATACCTTTCGCCGACGACATCATCCAGCGATGGACG
ACGTGCACGACCATGGTCGACTACGAGTCCGTTGCCGGCGGTGATAAGTTCGGAAACCTCTTCCTCGTGCGTTGC
CCTCCGAAAGTGAGCCAAGAGGCAGACGAGGAGGATTCGGGCATCCACTTGGTAAACGCGAGGTCTTATATGCAC
GGATGCGCGTGGCGACACGACCTTGTGTGCCACTTTTACACCAATGACATTCCCACCAGCGTCACCAAGACCAGC
CTCGTCGTTGGAGGCCAGGACGTGTTGCTGTGGAGTGGACTCATGGGGACCATCGGTGTACTCATCCCCCTCGTG
AGCAGGGAGGATGCCGACTTCTTCCAGAGCCTGGAGCAGCACCTCCGCAGCGAGGACCCGCCGTTGGCCGGACGA
GATCACCTTATCTACCGCGGTTACTACGCCCCGGTGAAAGGCGTCATTGACGGCGACCTCTGCGAGCGGTACAAC
CTGCTCAGCCAGGAAAAGAAGGCCATGATTGCGGGGGAACTGGACCGATCTGTTCGGGAGATTGAAAGGAAAATC
TCGGTACCGACGCGCCCGCCTCGAATGTGTCTGCGCTGCAGATTGGCTGACCAGATGACATGTTTAGGATGTCCG
GACTCGATCTGCTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail