Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5809
Gene name
Locationscaffold_488:1720..3308
Strand-
Gene length (bp)1588
Transcript length (bp)1476
Coding sequence length (bp)1473
Protein length (aa) 491

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20179 MSS51_C MSS51 C-terminal domain 1.5E-42 252 459
PF13824 zf-Mss51 Zinc-finger of mitochondrial splicing suppressor 51 7.6E-29 101 176

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32335|MSS51_YEAST Protein MSS51, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS51 PE=1 SV=2 76 487 2.0E-86
sp|Q9UTB4|MSS51_SCHPO Protein mss51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss51 PE=3 SV=1 77 489 1.0E-67

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1892 0.1504 0.0221 0.0831 0.9036 0.0335 0.0365 0.0588 0.1218 0.0134

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6925
Ophiocordyceps australis map64 (Brazil) OphauB2|782
Ophiocordyceps camponoti-floridani Ophcf2|04503
Ophiocordyceps camponoti-rufipedis Ophun1|5647
Ophiocordyceps kimflemingae Ophio5|5809 (this protein)
Ophiocordyceps subramaniannii Hirsu2|37

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5809
MESAMRRATLKLCGRCSRQAALPRSAKPWPGISLASGGLPISNVRAFTTSPNSKTETVAATDGAAVPTSVLLKQD
NLFHPFSSSPIALFRRRAAFMRQHAYCPHPDHQLTRLPTVKPVPDGAPTTGGDMKPAHVDFECPDCGFPVYCSKE
HWMDHYDRHLEICDTLRQINEDEHDLRSGRVFHEANLADVQLEEALVNMSSWDTFMYTREFKALDSDRSMRQITR
LLTYPISIASVIHELSPYDVKKGRRLTLEGLKSLGALRYNLHPRKDGRGPGVRELKPDPPAVRIFILGARAESSL
PRPIWVQLAHLFPSSRLHLILIGPESMANRDDEFPLPKRTASNPFGAVVEDRVWYRMKISTIVDYYHTIHKTGYF
APYDPYFDCFVLFHPGLGHPASSHEWAETLPLLLETKVPIISTGYTQFDLERDVEWVKKESKGEFDILLEPGENL
FRSLRWDLNDLDLQDFTCGNWGIWAFRGKRYETTTKDLEGV
Coding >Ophio5|5809
ATGGAGTCAGCGATGCGCAGAGCGACATTGAAGCTATGCGGACGATGCTCCAGGCAGGCAGCCTTGCCAAGGTCT
GCGAAGCCATGGCCTGGAATCTCCTTGGCTAGTGGAGGGCTCCCGATATCGAATGTTAGAGCTTTCACGACGAGC
CCCAATTCCAAGACGGAAACCGTCGCTGCGACCGATGGAGCTGCAGTGCCGACTTCTGTATTACTGAAGCAAGAC
AACCTGTTCCATCCCTTTTCGTCGTCTCCTATTGCCCTTTTTAGACGCCGTGCAGCATTCATGAGGCAGCACGCC
TACTGCCCGCATCCAGACCATCAACTGACCAGGCTGCCGACTGTGAAGCCAGTCCCGGATGGAGCCCCCACGACG
GGGGGTGACATGAAGCCTGCACATGTGGACTTTGAGTGTCCCGACTGCGGCTTTCCCGTGTACTGCAGCAAGGAG
CACTGGATGGACCACTACGATCGTCACCTCGAGATATGCGACACTCTGCGTCAAATCAACGAAGACGAGCACGAC
CTCCGGTCTGGGCGGGTGTTCCATGAGGCCAATCTAGCAGACGTGCAGCTGGAAGAGGCGCTCGTCAACATGTCA
AGCTGGGACACGTTTATGTACACGAGAGAGTTTAAAGCCCTCGACTCGGATCGCTCGATGAGACAGATTACCCGG
CTTCTCACCTACCCAATCTCCATTGCGAGCGTGATACACGAGCTAAGCCCCTACGACGTCAAAAAGGGCAGGCGG
CTTACCTTGGAAGGGCTGAAGAGTCTAGGAGCCCTCAGGTACAACTTGCATCCCCGCAAGGACGGACGTGGACCG
GGCGTCAGGGAATTGAAGCCAGATCCACCAGCCGTGAGGATCTTTATCCTCGGAGCGCGGGCAGAGTCGTCGTTG
CCGCGGCCGATTTGGGTGCAGCTGGCTCACCTGTTTCCTTCGTCTCGCCTTCATCTCATCCTGATCGGCCCTGAA
AGCATGGCGAATCGGGACGACGAGTTCCCGTTGCCCAAGCGTACAGCGTCGAACCCCTTTGGCGCCGTGGTCGAG
GACCGCGTGTGGTACCGGATGAAGATCAGCACGATTGTGGACTACTATCACACCATTCACAAGACGGGTTACTTT
GCGCCTTACGATCCCTACTTTGACTGCTTTGTCCTGTTCCACCCGGGTCTCGGGCATCCGGCGAGCAGCCACGAG
TGGGCCGAGACGCTACCGCTGCTGCTGGAGACGAAAGTGCCCATCATTAGCACCGGATACACTCAGTTCGATCTC
GAGCGTGACGTCGAGTGGGTGAAGAAGGAGTCCAAGGGCGAGTTTGACATTTTGCTGGAGCCCGGGGAGAACCTG
TTTCGAAGTCTGCGGTGGGACCTGAACGACCTGGATCTGCAGGACTTTACCTGCGGAAACTGGGGGATATGGGCC
TTTCGAGGCAAGAGGTACGAGACGACGACCAAGGACCTGGAGGGCGTG
Transcript >Ophio5|5809
ATGGAGTCAGCGATGCGCAGAGCGACATTGAAGCTATGCGGACGATGCTCCAGGCAGGCAGCCTTGCCAAGGTCT
GCGAAGCCATGGCCTGGAATCTCCTTGGCTAGTGGAGGGCTCCCGATATCGAATGTTAGAGCTTTCACGACGAGC
CCCAATTCCAAGACGGAAACCGTCGCTGCGACCGATGGAGCTGCAGTGCCGACTTCTGTATTACTGAAGCAAGAC
AACCTGTTCCATCCCTTTTCGTCGTCTCCTATTGCCCTTTTTAGACGCCGTGCAGCATTCATGAGGCAGCACGCC
TACTGCCCGCATCCAGACCATCAACTGACCAGGCTGCCGACTGTGAAGCCAGTCCCGGATGGAGCCCCCACGACG
GGGGGTGACATGAAGCCTGCACATGTGGACTTTGAGTGTCCCGACTGCGGCTTTCCCGTGTACTGCAGCAAGGAG
CACTGGATGGACCACTACGATCGTCACCTCGAGATATGCGACACTCTGCGTCAAATCAACGAAGACGAGCACGAC
CTCCGGTCTGGGCGGGTGTTCCATGAGGCCAATCTAGCAGACGTGCAGCTGGAAGAGGCGCTCGTCAACATGTCA
AGCTGGGACACGTTTATGTACACGAGAGAGTTTAAAGCCCTCGACTCGGATCGCTCGATGAGACAGATTACCCGG
CTTCTCACCTACCCAATCTCCATTGCGAGCGTGATACACGAGCTAAGCCCCTACGACGTCAAAAAGGGCAGGCGG
CTTACCTTGGAAGGGCTGAAGAGTCTAGGAGCCCTCAGGTACAACTTGCATCCCCGCAAGGACGGACGTGGACCG
GGCGTCAGGGAATTGAAGCCAGATCCACCAGCCGTGAGGATCTTTATCCTCGGAGCGCGGGCAGAGTCGTCGTTG
CCGCGGCCGATTTGGGTGCAGCTGGCTCACCTGTTTCCTTCGTCTCGCCTTCATCTCATCCTGATCGGCCCTGAA
AGCATGGCGAATCGGGACGACGAGTTCCCGTTGCCCAAGCGTACAGCGTCGAACCCCTTTGGCGCCGTGGTCGAG
GACCGCGTGTGGTACCGGATGAAGATCAGCACGATTGTGGACTACTATCACACCATTCACAAGACGGGTTACTTT
GCGCCTTACGATCCCTACTTTGACTGCTTTGTCCTGTTCCACCCGGGTCTCGGGCATCCGGCGAGCAGCCACGAG
TGGGCCGAGACGCTACCGCTGCTGCTGGAGACGAAAGTGCCCATCATTAGCACCGGATACACTCAGTTCGATCTC
GAGCGTGACGTCGAGTGGGTGAAGAAGGAGTCCAAGGGCGAGTTTGACATTTTGCTGGAGCCCGGGGAGAACCTG
TTTCGAAGTCTGCGGTGGGACCTGAACGACCTGGATCTGCAGGACTTTACCTGCGGAAACTGGGGGATATGGGCC
TTTCGAGGCAAGAGGTACGAGACGACGACCAAGGACCTGGAGGGCGTGTGA
Gene >Ophio5|5809
ATGGAGTCAGCGATGCGCAGAGCGACATTGAAGCTATGCGGACGATGCTCCAGGCAGGCAGCCTTGCCAAGGTCT
GCGAAGCCATGGCCTGGAATCTCCTTGGCTAGTGGAGGGCTCCCGATATCGAATGTTAGAGCTTTCACGACGAGC
CCCAATTCCAAGACGGAAACCGTCGCTGCGACCGATGGAGCTGCAGTGCCGACTTCTGTATTACTGAAGCAAGAC
AACCTGTTCCATCCCTTTTCGTCGTCTCCTATTGCCCTTTTTAGACGCCGTGCAGCATTCATGAGGCAGCACGCC
TACTGCCCGCATCCAGACCATCAACTGACCAGGCTGCCGACTGTGAAGCCAGTCCCGGATGGAGCCCCCACGACG
GGGGGTGACATGAAGCCTGCACATGTGGACTTTGAGTGTCCCGACTGCGGCTTTCCCGTGTACTGCAGCAAGGAG
CACTGGATGGACCACTACGATCGTCACCTCGAGATATGCGACACTCTGCGTCAAATCAACGAAGACGAGCACGAC
CTCCGGTCTGGGCGGGTGTTCCATGAGGCCAATCTAGCAGACGTGCAGCTGGAAGAGGCGCTCGTCAACATGTCA
AGCTGGGACACGTTTATGTACACGAGAGAGTTTAAAGCCCTCGACTCGGATCGCTCGATGAGACAGATTACCCGG
CTTCTCACCTACCCAATCTCCATTGCGAGCGTGATACACGAGCTAAGCCCCTACGACGTCAAAAAGGGCAGGCGG
CTTACCTTGGAAGGGCTGAAGAGTCTAGGAGGTGCGTGCGTCTTGGAAGTCGAGTCATGGAAGTAAGTAATTGGC
TCACATGTCATAGCCCTCAGGTACAACTTGCATCCCCGCAAGGACGGACGTGGACCGGGCGTCAGGGAATTGAAG
CCAGATCCACCAGCCGTGAGGATCTTTATCCTCGGAGCGCGGGCAGAGTCGTCGTTGCCGCGGCCGATTTGGGTG
CAGCTGGCTCACCTGTTTCCTTCGTCTCGCCTTCATCTCATCCTGATCGGCCCTGAAAGCATGGCGAATCGGGAC
GACGAGTTCCCGTTGCCCAAGCGTACAGCGTCGAACCCCTTTGGCGCCGTGGTCGAGGACCGCGTGTGGTACCGG
ATGAAGATCAGCACGATTGTGGACTACTATCACACCATTCACAAGACGGGTTACTTTGCGCCTTACGATCCCTAC
TTTGACTGCTTTGTCCTGTTCCACCCGGGTCTCGGGCATCCGGCGAGCAGCCACGAGTGGGCCGAGACGCTACCG
CTGCTGCTGGAGACGAAAGTGCCCATCATTAGCACCGGATACACTCAGTTCGATCTCGAGCGTGACGTCGAGTGG
GTGAAGAAGGAGTCCAAGGGCGAGTTTGACATTTTGCTGGAGCCCGGGGAGAACCTGTTTCGAAGTCTGCGGTGG
GACCTGAACGACCTGGATCTGCAGGACTTTACCTGCGGAAACTGGGGGATATGGGCCTTTCGAGGCAAGAGGTAT
GTGATTGACGTGTCTCGAGGTTTATGGGTGTTGATGGACTGACGGGGTTAGGTACGAGACGACGACCAAGGACCT
GGAGGGCGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail