Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5806
Gene name
Locationscaffold_487:11099..12068
Strand-
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01351 RNase_HII Ribonuclease HII 6.7E-47 48 266

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 8 322 6.0E-118
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 1 315 6.0E-78
sp|Q54D13|RNH2A_DICDI Ribonuclease H2 subunit A OS=Dictyostelium discoideum GN=rnaseh2A PE=3 SV=1 45 304 5.0E-54
sp|Q2TBT5|RNH2A_BOVIN Ribonuclease H2 subunit A OS=Bos taurus GN=RNASEH2A PE=1 SV=1 31 297 4.0E-53
sp|Q9U6P6|RNH2A_CAEEL Ribonuclease H2 subunit A OS=Caenorhabditis elegans GN=rnh-2 PE=2 SV=1 45 302 8.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P5X8|RNH2A_NEUCR Ribonuclease H2 subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnh-201 PE=3 SV=1 8 322 6.0E-118
sp|Q10236|RNH2A_SCHPO Ribonuclease H2 subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh201 PE=3 SV=1 1 315 6.0E-78
sp|Q54D13|RNH2A_DICDI Ribonuclease H2 subunit A OS=Dictyostelium discoideum GN=rnaseh2A PE=3 SV=1 45 304 5.0E-54
sp|Q2TBT5|RNH2A_BOVIN Ribonuclease H2 subunit A OS=Bos taurus GN=RNASEH2A PE=1 SV=1 31 297 4.0E-53
sp|Q9U6P6|RNH2A_CAEEL Ribonuclease H2 subunit A OS=Caenorhabditis elegans GN=rnh-2 PE=2 SV=1 45 302 8.0E-53
sp|O75792|RNH2A_HUMAN Ribonuclease H2 subunit A OS=Homo sapiens GN=RNASEH2A PE=1 SV=2 45 298 1.0E-51
sp|Q5U209|RNH2A_RAT Ribonuclease H2 subunit A OS=Rattus norvegicus GN=Rnaseh2a PE=2 SV=1 45 297 2.0E-50
sp|Q9CWY8|RNH2A_MOUSE Ribonuclease H2 subunit A OS=Mus musculus GN=Rnaseh2a PE=1 SV=2 45 278 6.0E-50
sp|Q9SEZ6|RNH2A_ARATH Ribonuclease H2 subunit A OS=Arabidopsis thaliana GN=At2g25100 PE=2 SV=2 45 290 8.0E-50
sp|Q9VPP5|RNH2A_DROME Ribonuclease H2 subunit A OS=Drosophila melanogaster GN=CG13690 PE=2 SV=1 29 283 1.0E-49
sp|P53942|RNH2A_YEAST Ribonuclease H2 subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH201 PE=1 SV=1 11 292 1.0E-49
sp|Q9V1A9|RNH2_PYRAB Ribonuclease HII OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnhB PE=3 SV=1 47 270 5.0E-24
sp|O59351|RNH2_PYRHO Ribonuclease HII OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnhB PE=1 SV=1 47 270 2.0E-23
sp|A1RYM0|RNH2_THEPD Ribonuclease HII OS=Thermofilum pendens (strain Hrk 5) GN=rnhB PE=3 SV=1 47 270 3.0E-22
sp|A9A9T9|RNH2_METM6 Ribonuclease HII OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnhB PE=3 SV=1 45 271 4.0E-22
sp|A6VGW0|RNH2_METM7 Ribonuclease HII OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnhB PE=3 SV=1 31 271 1.0E-21
sp|Q2NEI6|RNH2_METST Ribonuclease HII OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rnhB PE=3 SV=1 47 270 2.0E-21
sp|A4FWE5|RNH2_METM5 Ribonuclease HII OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rnhB PE=3 SV=1 31 271 2.0E-21
sp|O74035|RNH2_THEKO Ribonuclease HII OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnhB PE=1 SV=1 47 270 4.0E-21
sp|Q8U036|RNH2_PYRFU Ribonuclease HII OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnhB PE=3 SV=1 49 270 7.0E-21
sp|A5ULV6|RNH2_METS3 Ribonuclease HII OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rnhB PE=3 SV=1 47 270 2.0E-20
sp|Q9YET5|RNH2_AERPE Ribonuclease HII OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rnhB PE=3 SV=2 46 270 2.0E-20
sp|A2BL34|RNH2_HYPBU Ribonuclease HII OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rnhB PE=3 SV=1 48 298 2.0E-20
sp|P57673|RNH2_THEAC Ribonuclease HII OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rnhB PE=3 SV=1 49 280 3.0E-20
sp|Q97CG6|RNH2_THEVO Ribonuclease HII OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rnhB PE=3 SV=2 49 270 4.0E-20
sp|Q57599|RNH2_METJA Ribonuclease HII OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rnhB PE=1 SV=1 47 272 8.0E-20
sp|B6YVT5|RNH2_THEON Ribonuclease HII OS=Thermococcus onnurineus (strain NA1) GN=rnhB PE=3 SV=1 49 279 9.0E-19
sp|C6A1I4|RNH2_THESM Ribonuclease HII OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnhB PE=3 SV=1 49 270 2.0E-18
sp|A8MAH5|RNH2_CALMQ Ribonuclease HII OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rnhB PE=3 SV=1 49 274 2.0E-18
sp|A7I9P7|RNH2_METB6 Ribonuclease HII OS=Methanoregula boonei (strain 6A8) GN=rnhB PE=3 SV=1 47 274 8.0E-18
sp|O27102|RNH2_METTH Ribonuclease HII OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnhB PE=3 SV=1 47 268 1.0E-17
sp|Q6LXH7|RNH2_METMP Ribonuclease HII OS=Methanococcus maripaludis (strain S2 / LL) GN=rnhB PE=3 SV=1 44 271 2.0E-17
sp|Q74MH3|RNH2_NANEQ Ribonuclease HII OS=Nanoarchaeum equitans (strain Kin4-M) GN=rnhB PE=3 SV=1 49 242 3.0E-17
sp|Q468N6|RNH2_METBF Ribonuclease HII OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rnhB PE=3 SV=1 47 270 7.0E-17
sp|Q97W56|RNH2_SULSO Ribonuclease HII OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnhB PE=3 SV=1 48 264 7.0E-17
sp|Q8TYV5|RNH2_METKA Ribonuclease HII OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rnhB PE=3 SV=1 47 297 2.0E-16
sp|B1YB67|RNH2_PYRNV Ribonuclease HII OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rnhB PE=3 SV=1 49 268 3.0E-16
sp|Q0W5R8|RNH2_METAR Ribonuclease HII OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rnhB PE=3 SV=1 47 267 3.0E-16
sp|Q974Z3|RNH2_SULTO Ribonuclease HII OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rnhB PE=3 SV=1 46 270 5.0E-16
sp|Q6KZK4|RNH2_PICTO Ribonuclease HII OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rnhB PE=3 SV=1 46 273 6.0E-16
sp|Q4JA60|RNH2_SULAC Ribonuclease HII OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rnhB PE=3 SV=1 46 270 6.0E-16
sp|A2STJ6|RNH2_METLZ Ribonuclease HII OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rnhB PE=3 SV=1 47 272 1.0E-15
sp|Q12YN9|RNH2_METBU Ribonuclease HII OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rnhB PE=3 SV=1 47 271 1.0E-15
sp|A6UQ18|RNH2_METVS Ribonuclease HII OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rnhB PE=3 SV=1 44 271 3.0E-15
sp|Q8ZXL6|RNH2_PYRAE Ribonuclease HII OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rnhB PE=3 SV=1 49 266 7.0E-15
sp|Q2FP80|RNH2_METHJ Ribonuclease HII OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rnhB PE=3 SV=1 47 282 9.0E-15
sp|A0RV25|RNH2_CENSY Ribonuclease HII OS=Cenarchaeum symbiosum (strain A) GN=rnhB PE=3 SV=1 47 268 2.0E-14
sp|O29634|RNH2_ARCFU Ribonuclease HII OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rnhB PE=1 SV=1 49 270 2.0E-14
sp|A1RU36|RNH2_PYRIL Ribonuclease HII OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rnhB PE=3 SV=1 47 268 7.0E-14
sp|A4WHQ7|RNH2_PYRAR Ribonuclease HII OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rnhB PE=3 SV=1 49 271 2.0E-12
sp|A1U3P0|RNH2_MARHV Ribonuclease HII OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnhB PE=3 SV=1 49 272 9.0E-12
sp|B7IF45|RNH2_THEAB Ribonuclease HII OS=Thermosipho africanus (strain TCF52B) GN=rnhB PE=3 SV=1 46 271 1.0E-11
sp|B3QQY0|RNH2_CHLP8 Ribonuclease HII OS=Chlorobaculum parvum (strain NCIB 8327) GN=rnhB PE=3 SV=1 47 238 2.0E-11
sp|C4K435|RNH2_HAMD5 Ribonuclease HII OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rnhB PE=3 SV=1 46 238 3.0E-11
sp|A2BYM8|RNH2_PROM5 Ribonuclease HII OS=Prochlorococcus marinus (strain MIT 9515) GN=rnhB PE=3 SV=1 48 249 4.0E-11
sp|Q6G4E3|RNH2_BARHE Ribonuclease HII OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnhB PE=3 SV=1 47 268 5.0E-11
sp|A6V1E6|RNH2_PSEA7 Ribonuclease HII OS=Pseudomonas aeruginosa (strain PA7) GN=rnhB PE=3 SV=1 47 272 6.0E-11
sp|A0B796|RNH2_METTP Ribonuclease HII OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rnhB PE=3 SV=1 46 270 7.0E-11
sp|Q02RB4|RNH2_PSEAB Ribonuclease HII OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rnhB PE=3 SV=1 47 272 7.0E-11
sp|Q4JV11|RNH2_CORJK Ribonuclease HII OS=Corynebacterium jeikeium (strain K411) GN=rnhB PE=3 SV=1 38 264 1.0E-10
sp|A4VJT5|RNH2_PSEU5 Ribonuclease HII OS=Pseudomonas stutzeri (strain A1501) GN=rnhB PE=3 SV=1 47 280 1.0E-10
sp|B7V7U6|RNH2_PSEA8 Ribonuclease HII OS=Pseudomonas aeruginosa (strain LESB58) GN=rnhB PE=3 SV=1 47 272 3.0E-10
sp|Q0KA30|RNH2_CUPNH Ribonuclease HII OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rnhB PE=3 SV=1 49 271 3.0E-10
sp|Q470F1|RNH2_CUPPJ Ribonuclease HII OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rnhB PE=3 SV=1 49 271 3.0E-10
sp|B7HDW0|RNH2_BACC4 Ribonuclease HII OS=Bacillus cereus (strain B4264) GN=rnhB PE=3 SV=1 47 271 3.0E-10
sp|Q819W9|RNH2_BACCR Ribonuclease HII OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rnhB PE=3 SV=1 47 271 4.0E-10
sp|Q9HXY9|RNH2_PSEAE Ribonuclease HII OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rnhB PE=3 SV=1 47 272 4.0E-10
sp|Q1GUJ1|RNH2_SPHAL Ribonuclease HII OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rnhB PE=3 SV=1 47 290 6.0E-10
sp|A1URV4|RNH2_BARBK Ribonuclease HII OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rnhB PE=3 SV=1 47 268 6.0E-10
sp|Q4KHG2|RNH2_PSEF5 Ribonuclease HII OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rnhB PE=3 SV=2 47 253 7.0E-10
sp|Q9K1G1|RNH2_NEIMB Ribonuclease HII OS=Neisseria meningitidis serogroup B (strain MC58) GN=rnhB PE=3 SV=1 49 275 8.0E-10
sp|Q9JX40|RNH2_NEIMA Ribonuclease HII OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rnhB PE=3 SV=1 49 275 9.0E-10
sp|C5D8U9|RNH2_GEOSW Ribonuclease HII OS=Geobacillus sp. (strain WCH70) GN=rnhB PE=3 SV=1 47 281 1.0E-09
sp|Q3KH98|RNH2_PSEPF Ribonuclease HII OS=Pseudomonas fluorescens (strain Pf0-1) GN=rnhB PE=3 SV=1 47 253 1.0E-09
sp|C0R4W4|RNH2_WOLWR Ribonuclease HII OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rnhB PE=3 SV=1 35 218 1.0E-09
sp|Q73G60|RNH2_WOLPM Ribonuclease HII OS=Wolbachia pipientis wMel GN=rnhB PE=3 SV=1 35 218 2.0E-09
sp|Q21HI6|RNH2_SACD2 Ribonuclease HII OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rnhB PE=3 SV=1 47 247 2.0E-09
sp|B1JBP6|RNH2_PSEPW Ribonuclease HII OS=Pseudomonas putida (strain W619) GN=rnhB PE=3 SV=1 47 253 2.0E-09
sp|Q3IRF6|RNH2_NATPD Ribonuclease HII OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rnhB PE=3 SV=1 47 268 2.0E-09
sp|Q83BZ8|RNH2_COXBU Ribonuclease HII OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rnhB PE=3 SV=1 47 270 2.0E-09
sp|A9N8L5|RNH2_COXBR Ribonuclease HII OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rnhB PE=3 SV=1 47 270 2.0E-09
sp|A9KGD3|RNH2_COXBN Ribonuclease HII OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rnhB PE=3 SV=1 47 270 2.0E-09
sp|B6J7Z2|RNH2_COXB1 Ribonuclease HII OS=Coxiella burnetii (strain CbuK_Q154) GN=rnhB PE=3 SV=1 47 270 2.0E-09
sp|Q7UZZ2|RNH2_PROMP Ribonuclease HII OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rnhB PE=3 SV=1 48 251 2.0E-09
sp|Q12NX3|RNH2_SHEDO Ribonuclease HII OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rnhB PE=3 SV=1 46 264 2.0E-09
sp|A1WHV6|RNH2_VEREI Ribonuclease HII OS=Verminephrobacter eiseniae (strain EF01-2) GN=rnhB PE=3 SV=1 47 212 2.0E-09
sp|B6IZE4|RNH2_COXB2 Ribonuclease HII OS=Coxiella burnetii (strain CbuG_Q212) GN=rnhB PE=3 SV=1 47 270 3.0E-09
sp|Q886M9|RNH2_PSESM Ribonuclease HII OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rnhB PE=3 SV=1 47 276 3.0E-09
sp|Q6MDG7|RNH2_PARUW Ribonuclease HII OS=Protochlamydia amoebophila (strain UWE25) GN=rnhB PE=3 SV=1 47 276 3.0E-09
sp|Q5GRZ4|RNH2_WOLTR Ribonuclease HII OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rnhB PE=3 SV=1 35 218 3.0E-09
sp|A9IQL1|RNH2_BART1 Ribonuclease HII OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rnhB PE=3 SV=1 47 269 3.0E-09
sp|C1DST2|RNH2_AZOVD Ribonuclease HII OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rnhB PE=3 SV=1 47 272 3.0E-09
sp|B3CM59|RNH2_WOLPP Ribonuclease HII OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rnhB PE=3 SV=1 35 218 4.0E-09
sp|A5G7Z2|RNH2_GEOUR Ribonuclease HII OS=Geobacter uraniireducens (strain Rf4) GN=rnhB PE=3 SV=1 46 248 5.0E-09
sp|Q6G0E6|RNH2_BARQU Ribonuclease HII OS=Bartonella quintana (strain Toulouse) GN=rnhB PE=3 SV=1 47 268 5.0E-09
sp|Q88MG6|RNH2_PSEPK Ribonuclease HII OS=Pseudomonas putida (strain KT2440) GN=rnhB PE=3 SV=1 47 253 5.0E-09
sp|Q8XZH7|RNH2_RALSO Ribonuclease HII OS=Ralstonia solanacearum (strain GMI1000) GN=rnhB PE=3 SV=1 49 273 6.0E-09
sp|A5W836|RNH2_PSEP1 Ribonuclease HII OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnhB PE=3 SV=1 47 272 6.0E-09
sp|A9VT75|RNH2_BACWK Ribonuclease HII OS=Bacillus weihenstephanensis (strain KBAB4) GN=rnhB PE=3 SV=1 47 272 6.0E-09
sp|Q31G56|RNH2_THICR Ribonuclease HII OS=Thiomicrospira crunogena (strain XCL-2) GN=rnhB PE=3 SV=1 47 271 6.0E-09
sp|A1KRM4|RNH2_NEIMF Ribonuclease HII OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rnhB PE=3 SV=1 49 275 8.0E-09
sp|B0KSB3|RNH2_PSEPG Ribonuclease HII OS=Pseudomonas putida (strain GB-1) GN=rnhB PE=3 SV=1 47 253 8.0E-09
sp|A0LV66|RNH2_ACIC1 Ribonuclease HII OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rnhB PE=3 SV=1 38 218 8.0E-09
sp|B7GGD5|RNH2_ANOFW Ribonuclease HII OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rnhB PE=3 SV=1 47 271 9.0E-09
sp|Q2YB96|RNH2_NITMU Ribonuclease HII OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rnhB PE=3 SV=1 45 244 1.0E-08
sp|B8I7T9|RNH2_CLOCE Ribonuclease HII OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rnhB PE=3 SV=1 47 264 1.0E-08
sp|Q65VI0|RNH2_MANSM Ribonuclease HII OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnhB PE=3 SV=1 46 274 1.0E-08
sp|A4JF61|RNH2_BURVG Ribonuclease HII OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rnhB PE=3 SV=1 47 235 1.0E-08
sp|Q4ZWR4|RNH2_PSEU2 Ribonuclease HII OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnhB PE=3 SV=1 47 253 2.0E-08
sp|Q5ZVR7|RNH2_LEGPH Ribonuclease HII OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rnhB PE=3 SV=1 49 247 2.0E-08
sp|Q0BE29|RNH2_BURCM Ribonuclease HII OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rnhB PE=3 SV=1 47 238 2.0E-08
sp|O33022|RNH2_MYCLE Ribonuclease HII OS=Mycobacterium leprae (strain TN) GN=rnhB PE=3 SV=1 47 271 2.0E-08
sp|B8ZRW3|RNH2_MYCLB Ribonuclease HII OS=Mycobacterium leprae (strain Br4923) GN=rnhB PE=3 SV=1 47 271 2.0E-08
sp|A1BCI1|RNH2_CHLPD Ribonuclease HII OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rnhB PE=3 SV=1 46 244 3.0E-08
sp|B1YS60|RNH2_BURA4 Ribonuclease HII OS=Burkholderia ambifaria (strain MC40-6) GN=rnhB PE=3 SV=1 47 238 3.0E-08
sp|Q2G794|RNH2_NOVAD Ribonuclease HII OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rnhB PE=3 SV=1 47 238 3.0E-08
sp|P0A4E0|RNH2_BRUSU Ribonuclease HII OS=Brucella suis biovar 1 (strain 1330) GN=rnhB PE=3 SV=1 47 236 3.0E-08
sp|P0A4D9|RNH2_BRUME Ribonuclease HII OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rnhB PE=3 SV=1 47 236 3.0E-08
sp|C0RH97|RNH2_BRUMB Ribonuclease HII OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rnhB PE=3 SV=1 47 236 3.0E-08
sp|A9M8G2|RNH2_BRUC2 Ribonuclease HII OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rnhB PE=3 SV=1 47 236 3.0E-08
sp|A6WW84|RNH2_OCHA4 Ribonuclease HII OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rnhB PE=3 SV=1 47 236 3.0E-08
sp|Q1LNE4|RNH2_CUPMC Ribonuclease HII OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rnhB PE=3 SV=1 49 272 4.0E-08
sp|B4ECL7|RNH2_BURCJ Ribonuclease HII OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rnhB PE=3 SV=1 47 235 4.0E-08
sp|Q5L0P0|RNH2_GEOKA Ribonuclease HII OS=Geobacillus kaustophilus (strain HTA426) GN=rnhB PE=3 SV=1 47 271 4.0E-08
sp|Q57EX6|RNH2_BRUAB Ribonuclease HII OS=Brucella abortus biovar 1 (strain 9-941) GN=rnhB PE=3 SV=1 47 236 4.0E-08
sp|Q2YMC3|RNH2_BRUA2 Ribonuclease HII OS=Brucella abortus (strain 2308) GN=rnhB PE=3 SV=1 47 236 4.0E-08
sp|Q5F5X9|RNH2_NEIG1 Ribonuclease HII OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rnhB PE=3 SV=1 49 275 4.0E-08
sp|A9BML8|RNH2_DELAS Ribonuclease HII OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rnhB PE=3 SV=1 26 219 4.0E-08
sp|A4XWS7|RNH2_PSEMY Ribonuclease HII OS=Pseudomonas mendocina (strain ymp) GN=rnhB PE=3 SV=1 47 272 5.0E-08
sp|A1TN83|RNH2_ACIAC Ribonuclease HII OS=Acidovorax citrulli (strain AAC00-1) GN=rnhB PE=3 SV=1 44 212 6.0E-08
sp|Q5WWX5|RNH2_LEGPL Ribonuclease HII OS=Legionella pneumophila (strain Lens) GN=rnhB PE=3 SV=1 49 247 6.0E-08
sp|B9DPH3|RNH2_STACT Ribonuclease HII OS=Staphylococcus carnosus (strain TM300) GN=rnhB PE=3 SV=1 30 271 6.0E-08
sp|B5F9W2|RNH2_VIBFM Ribonuclease HII OS=Vibrio fischeri (strain MJ11) GN=rnhB PE=3 SV=1 25 244 6.0E-08
sp|C3LQ18|RNH2_VIBCM Ribonuclease HII OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnhB PE=3 SV=1 46 271 6.0E-08
sp|P52021|RNH2_VIBCH Ribonuclease HII OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnhB PE=3 SV=2 46 271 6.0E-08
sp|A5F626|RNH2_VIBC3 Ribonuclease HII OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnhB PE=3 SV=1 46 271 6.0E-08
sp|Q5X5J3|RNH2_LEGPA Ribonuclease HII OS=Legionella pneumophila (strain Paris) GN=rnhB PE=3 SV=1 49 247 7.0E-08
sp|B2A2P0|RNH2_NATTJ Ribonuclease HII OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rnhB PE=3 SV=1 49 274 7.0E-08
sp|Q8KAA5|RNH2_CHLTE Ribonuclease HII OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rnhB PE=3 SV=1 47 247 8.0E-08
sp|A5IBL5|RNH2_LEGPC Ribonuclease HII OS=Legionella pneumophila (strain Corby) GN=rnhB PE=3 SV=1 49 247 8.0E-08
sp|Q46IX0|RNH2_PROMT Ribonuclease HII OS=Prochlorococcus marinus (strain NATL2A) GN=rnhB PE=3 SV=1 43 239 9.0E-08
sp|Q8NNZ4|RNH2_CORGL Ribonuclease HII OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rnhB PE=3 SV=1 47 264 1.0E-07
sp|A5GIN4|RNH2_SYNPW Ribonuclease HII OS=Synechococcus sp. (strain WH7803) GN=rnhB PE=3 SV=1 48 235 1.0E-07
sp|Q325V7|RNH2_SHIBS Ribonuclease HII OS=Shigella boydii serotype 4 (strain Sb227) GN=rnhB PE=3 SV=1 47 238 1.0E-07
sp|Q5E3F3|RNH2_VIBF1 Ribonuclease HII OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rnhB PE=3 SV=1 49 244 1.0E-07
sp|B2UBB5|RNH2_RALPJ Ribonuclease HII OS=Ralstonia pickettii (strain 12J) GN=rnhB PE=3 SV=1 49 276 1.0E-07
sp|Q72DU5|RNH2_DESVH Ribonuclease HII OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rnhB PE=3 SV=1 43 218 1.0E-07
sp|A5VNW6|RNH2_BRUO2 Ribonuclease HII OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rnhB PE=3 SV=1 47 236 1.0E-07
sp|Q5NNT2|RNH2_ZYMMO Ribonuclease HII OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnhB PE=3 SV=1 21 247 1.0E-07
sp|A1K6Q7|RNH2_AZOSB Ribonuclease HII OS=Azoarcus sp. (strain BH72) GN=rnhB PE=3 SV=1 47 273 1.0E-07
sp|B5EBC6|RNH2_GEOBB Ribonuclease HII OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rnhB PE=3 SV=1 47 246 1.0E-07
sp|Q39F57|RNH2_BURL3 Ribonuclease HII OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rnhB PE=3 SV=1 47 235 2.0E-07
sp|A0K8C9|RNH2_BURCH Ribonuclease HII OS=Burkholderia cenocepacia (strain HI2424) GN=rnhB PE=3 SV=1 47 235 2.0E-07
sp|Q1BHG8|RNH2_BURCA Ribonuclease HII OS=Burkholderia cenocepacia (strain AU 1054) GN=rnhB PE=3 SV=1 47 235 2.0E-07
sp|B1JUD6|RNH2_BURCC Ribonuclease HII OS=Burkholderia cenocepacia (strain MC0-3) GN=rnhB PE=3 SV=1 47 235 2.0E-07
sp|Q3B6X8|RNH2_CHLL7 Ribonuclease HII OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rnhB PE=3 SV=1 47 253 2.0E-07
sp|B0CK74|RNH2_BRUSI Ribonuclease HII OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rnhB PE=3 SV=1 47 236 2.0E-07
sp|B1LGY5|RNH2_ECOSM Ribonuclease HII OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|B7N850|RNH2_ECOLU Ribonuclease HII OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|Q0TLF0|RNH2_ECOL5 Ribonuclease HII OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|B7MP43|RNH2_ECO81 Ribonuclease HII OS=Escherichia coli O81 (strain ED1a) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|B7UJ84|RNH2_ECO27 Ribonuclease HII OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|Q2NCP5|RNH2_ERYLH Ribonuclease HII OS=Erythrobacter litoralis (strain HTCC2594) GN=rnhB PE=3 SV=1 36 212 2.0E-07
sp|Q318P1|RNH2_PROM9 Ribonuclease HII OS=Prochlorococcus marinus (strain MIT 9312) GN=rnhB PE=3 SV=1 48 218 2.0E-07
sp|Q83MN1|RNH2_SHIFL Ribonuclease HII OS=Shigella flexneri GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|Q0T826|RNH2_SHIF8 Ribonuclease HII OS=Shigella flexneri serotype 5b (strain 8401) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|Q32JS6|RNH2_SHIDS Ribonuclease HII OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|Q8FL06|RNH2_ECOL6 Ribonuclease HII OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnhB PE=3 SV=1 47 238 2.0E-07
sp|Q3Z5H5|RNH2_SHISS Ribonuclease HII OS=Shigella sonnei (strain Ss046) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|B6HZF7|RNH2_ECOSE Ribonuclease HII OS=Escherichia coli (strain SE11) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|P10442|RNH2_ECOLI Ribonuclease HII OS=Escherichia coli (strain K12) GN=rnhB PE=1 SV=2 46 261 2.0E-07
sp|A7ZWC9|RNH2_ECOHS Ribonuclease HII OS=Escherichia coli O9:H4 (strain HS) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|B1XD52|RNH2_ECODH Ribonuclease HII OS=Escherichia coli (strain K12 / DH10B) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|C4ZRS5|RNH2_ECOBW Ribonuclease HII OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|B7M1Y6|RNH2_ECO8A Ribonuclease HII OS=Escherichia coli O8 (strain IAI1) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|B7LGP5|RNH2_ECO55 Ribonuclease HII OS=Escherichia coli (strain 55989 / EAEC) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|A7ZHS3|RNH2_ECO24 Ribonuclease HII OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnhB PE=3 SV=1 46 261 2.0E-07
sp|Q2SWY4|RNH2_BURTA Ribonuclease HII OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rnhB PE=3 SV=1 47 238 3.0E-07
sp|A3QG89|RNH2_SHELP Ribonuclease HII OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rnhB PE=3 SV=1 49 272 3.0E-07
sp|A1VFE7|RNH2_DESVV Ribonuclease HII OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rnhB PE=3 SV=1 43 218 3.0E-07
sp|Q9Z9S0|RNH2_BACHD Ribonuclease HII OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rnhB PE=3 SV=2 47 264 3.0E-07
sp|Q38WY6|RNH2_LACSS Ribonuclease HII OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rnhB PE=3 SV=1 45 253 3.0E-07
sp|Q7MIH3|RNH2_VIBVY Ribonuclease HII OS=Vibrio vulnificus (strain YJ016) GN=rnhB PE=3 SV=1 31 240 3.0E-07
sp|Q8DBE7|RNH2_VIBVU Ribonuclease HII OS=Vibrio vulnificus (strain CMCP6) GN=rnhB PE=3 SV=1 31 240 3.0E-07
sp|Q13XD0|RNH2_BURXL Ribonuclease HII OS=Burkholderia xenovorans (strain LB400) GN=rnhB PE=3 SV=1 47 238 3.0E-07
sp|B2U326|RNH2_SHIB3 Ribonuclease HII OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|B7NIE5|RNH2_ECO7I Ribonuclease HII OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|B5Z0G2|RNH2_ECO5E Ribonuclease HII OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|Q8X8X6|RNH2_ECO57 Ribonuclease HII OS=Escherichia coli O157:H7 GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|Q1RG06|RNH2_ECOUT Ribonuclease HII OS=Escherichia coli (strain UTI89 / UPEC) GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|A1A7M7|RNH2_ECOK1 Ribonuclease HII OS=Escherichia coli O1:K1 / APEC GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|B7MBG4|RNH2_ECO45 Ribonuclease HII OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnhB PE=3 SV=1 47 238 4.0E-07
sp|Q7U4C6|RNH2_SYNPX Ribonuclease HII OS=Synechococcus sp. (strain WH8102) GN=rnhB PE=3 SV=2 45 236 4.0E-07
sp|B7LW62|RNH2_ESCF3 Ribonuclease HII OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnhB PE=3 SV=1 47 238 5.0E-07
sp|A5D1I3|RNH2_PELTS Ribonuclease HII OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rnhB PE=3 SV=1 47 238 6.0E-07
sp|Q5YS47|RNH2_NOCFA Ribonuclease HII OS=Nocardia farcinica (strain IFM 10152) GN=rnhB PE=3 SV=1 47 271 7.0E-07
sp|A9M3R5|RNH2_NEIM0 Ribonuclease HII OS=Neisseria meningitidis serogroup C (strain 053442) GN=rnhB PE=3 SV=1 49 271 7.0E-07
sp|B2T5I0|RNH2_BURPP Ribonuclease HII OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rnhB PE=3 SV=1 47 243 8.0E-07
sp|Q12A45|RNH2_POLSJ Ribonuclease HII OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rnhB PE=3 SV=1 44 212 8.0E-07
sp|A1W904|RNH2_ACISJ Ribonuclease HII OS=Acidovorax sp. (strain JS42) GN=rnhB PE=3 SV=1 44 212 9.0E-07
sp|B9MGN1|RNH2_ACIET Ribonuclease HII OS=Acidovorax ebreus (strain TPSY) GN=rnhB PE=3 SV=1 44 212 9.0E-07
sp|A2BT77|RNH2_PROMS Ribonuclease HII OS=Prochlorococcus marinus (strain AS9601) GN=rnhB PE=3 SV=1 48 218 9.0E-07
sp|A5EV63|RNH2_DICNV Ribonuclease HII OS=Dichelobacter nodosus (strain VCS1703A) GN=rnhB PE=3 SV=1 47 253 9.0E-07
sp|B2VHY0|RNH2_ERWT9 Ribonuclease HII OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnhB PE=3 SV=1 47 269 1.0E-06
sp|Q73MG1|RNH2_TREDE Ribonuclease HII OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnhB PE=3 SV=1 49 215 1.0E-06
sp|Q5UXT4|RNH2_HALMA Ribonuclease HII OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rnhB PE=3 SV=1 48 271 1.0E-06
sp|A1VN54|RNH2_POLNA Ribonuclease HII OS=Polaromonas naphthalenivorans (strain CJ2) GN=rnhB PE=3 SV=1 44 212 2.0E-06
sp|B0SZF7|RNH2_CAUSK Ribonuclease HII OS=Caulobacter sp. (strain K31) GN=rnhB PE=3 SV=1 34 274 2.0E-06
sp|A0QJ41|RNH2_MYCA1 Ribonuclease HII OS=Mycobacterium avium (strain 104) GN=rnhB PE=3 SV=1 47 287 2.0E-06
sp|B1IQF8|RNH2_ECOLC Ribonuclease HII OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnhB PE=3 SV=1 47 261 2.0E-06
sp|Q2JKK9|RNH2_SYNJB Ribonuclease HII OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rnhB PE=3 SV=1 47 216 2.0E-06
sp|Q2IMM4|RNH2_ANADE Ribonuclease HII OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rnhB PE=3 SV=1 47 253 2.0E-06
sp|Q3JR43|RNH2_BURP1 Ribonuclease HII OS=Burkholderia pseudomallei (strain 1710b) GN=rnhB PE=3 SV=1 47 238 2.0E-06
sp|Q63T26|RNH2_BURPS Ribonuclease HII OS=Burkholderia pseudomallei (strain K96243) GN=rnhB PE=3 SV=1 47 238 2.0E-06
sp|A3NAT3|RNH2_BURP6 Ribonuclease HII OS=Burkholderia pseudomallei (strain 668) GN=rnhB PE=3 SV=1 47 238 2.0E-06
sp|P0A2C1|RNH2_SALTY Ribonuclease HII OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|P0A2C2|RNH2_SALTI Ribonuclease HII OS=Salmonella typhi GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|B5BAP0|RNH2_SALPK Ribonuclease HII OS=Salmonella paratyphi A (strain AKU_12601) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|Q5PD71|RNH2_SALPA Ribonuclease HII OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|B4SV12|RNH2_SALNS Ribonuclease HII OS=Salmonella newport (strain SL254) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|B4TK58|RNH2_SALHS Ribonuclease HII OS=Salmonella heidelberg (strain SL476) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|B5R422|RNH2_SALEP Ribonuclease HII OS=Salmonella enteritidis PT4 (strain P125109) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|B5FJ30|RNH2_SALDC Ribonuclease HII OS=Salmonella dublin (strain CT_02021853) GN=rnhB PE=3 SV=1 46 238 2.0E-06
sp|Q73VP3|RNH2_MYCPA Ribonuclease HII OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rnhB PE=3 SV=1 47 287 2.0E-06
sp|Q8FP63|RNH2_COREF Ribonuclease HII OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rnhB PE=3 SV=1 47 286 3.0E-06
sp|A8ALA5|RNH2_CITK8 Ribonuclease HII OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|B4TYE3|RNH2_SALSV Ribonuclease HII OS=Salmonella schwarzengrund (strain CVM19633) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|C0Q6K6|RNH2_SALPC Ribonuclease HII OS=Salmonella paratyphi C (strain RKS4594) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|A9N0T3|RNH2_SALPB Ribonuclease HII OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|B5R5I6|RNH2_SALG2 Ribonuclease HII OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|Q57T25|RNH2_SALCH Ribonuclease HII OS=Salmonella choleraesuis (strain SC-B67) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|B5F8U4|RNH2_SALA4 Ribonuclease HII OS=Salmonella agona (strain SL483) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|A9MPH8|RNH2_SALAR Ribonuclease HII OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnhB PE=3 SV=1 46 238 3.0E-06
sp|A4IM80|RNH2_GEOTN Ribonuclease HII OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rnhB PE=3 SV=1 47 238 3.0E-06
sp|A7MI15|RNH2_CROS8 Ribonuclease HII OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnhB PE=3 SV=1 46 238 4.0E-06
sp|A7NM86|RNH2_ROSCS Ribonuclease HII OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rnhB PE=3 SV=1 47 218 4.0E-06
sp|Q2LVU5|RNH2_SYNAS Ribonuclease HII OS=Syntrophus aciditrophicus (strain SB) GN=rnhB PE=3 SV=1 46 216 4.0E-06
sp|A3NWL6|RNH2_BURP0 Ribonuclease HII OS=Burkholderia pseudomallei (strain 1106a) GN=rnhB PE=3 SV=1 47 238 5.0E-06
sp|A1V554|RNH2_BURMS Ribonuclease HII OS=Burkholderia mallei (strain SAVP1) GN=rnhB PE=3 SV=1 47 238 5.0E-06
sp|Q62JD8|RNH2_BURMA Ribonuclease HII OS=Burkholderia mallei (strain ATCC 23344) GN=rnhB PE=3 SV=1 47 238 5.0E-06
sp|A2SB87|RNH2_BURM9 Ribonuclease HII OS=Burkholderia mallei (strain NCTC 10229) GN=rnhB PE=3 SV=1 47 238 5.0E-06
sp|A3MKS8|RNH2_BURM7 Ribonuclease HII OS=Burkholderia mallei (strain NCTC 10247) GN=rnhB PE=3 SV=1 47 238 5.0E-06
sp|P9WH01|RNH2_MYCTU Ribonuclease HII OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rnhB PE=1 SV=1 47 291 7.0E-06
sp|P9WH00|RNH2_MYCTO Ribonuclease HII OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rnhB PE=3 SV=1 47 291 7.0E-06
sp|A5U6Q7|RNH2_MYCTA Ribonuclease HII OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rnhB PE=3 SV=1 47 291 7.0E-06
sp|C1AG17|RNH2_MYCBT Ribonuclease HII OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rnhB PE=3 SV=1 47 291 7.0E-06
sp|A1KMP6|RNH2_MYCBP Ribonuclease HII OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rnhB PE=3 SV=1 47 291 7.0E-06
sp|Q7TXM7|RNH2_MYCBO Ribonuclease HII OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rnhB PE=3 SV=1 47 291 7.0E-06
sp|Q0AMK3|RNH2_MARMM Ribonuclease HII OS=Maricaulis maris (strain MCS10) GN=rnhB PE=3 SV=1 47 263 8.0E-06
sp|Q8UHG2|RNH2_AGRFC Ribonuclease HII OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rnhB PE=3 SV=2 47 243 8.0E-06
sp|A2CC94|RNH2_PROM3 Ribonuclease HII OS=Prochlorococcus marinus (strain MIT 9303) GN=rnhB PE=3 SV=1 47 236 9.0E-06
sp|B7IUJ6|RNH2_BACC2 Ribonuclease HII OS=Bacillus cereus (strain G9842) GN=rnhB PE=3 SV=1 47 271 9.0E-06
sp|B4SAK8|RNH2_PELPB Ribonuclease HII OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rnhB PE=3 SV=1 47 253 1.0E-05
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4688 0.672 0.045 0.0012 0.39 0.0099 0.0818 0.135 0.0796 0.0899

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2091
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7852
Ophiocordyceps australis map64 (Brazil) OphauB2|6510
Ophiocordyceps camponoti-floridani Ophcf2|06603
Ophiocordyceps camponoti-rufipedis Ophun1|7375
Ophiocordyceps kimflemingae Ophio5|5806 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5806
MDESAVAAATFVPPSIHADTLVSGSSYTHLSDIPPALLASPSLPPCVLGIDEAGRGPVLGPMVYAAFVLPSSLST
TLLREKYGFDDSKALTPALRTQLMRSLCTAGSDLHDVCAWAVSVLSARDISAAMMRPAGPHTLNAQAFDATVELI
RRVCEAGVNVREIYVDAVGPPVPYQARLQRLFPTATVVVANKADSLYPCVSAASVCAKVTRDAALEHLFAARAPS
SGSGLSWGSGYPSDARCVAWMRANLHPIFGWGPECRFSWGTAKDMLDGKAAAVKVDWPLPHDADSRRLTDYFLPN
ADERGSDELGSWFGTSVGLEAL
Coding >Ophio5|5806
ATGGACGAGTCCGCCGTCGCCGCCGCCACCTTTGTCCCGCCGTCCATCCATGCCGACACCCTCGTCTCCGGCTCC
TCCTACACACACCTCTCCGACATCCCGCCCGCCCTCCTCGCCTCCCCTTCCCTGCCACCATGCGTCCTCGGTATC
GACGAAGCCGGTCGGGGTCCCGTGCTGGGCCCCATGGTCTACGCCGCCTTCGTCCTCCCCTCTTCGCTGTCGACG
ACGCTGCTCCGGGAGAAGTACGGCTTCGACGACTCCAAGGCGCTGACGCCCGCCCTTCGCACCCAGCTGATGCGC
TCCCTCTGCACCGCCGGCTCCGACCTTCACGACGTCTGCGCCTGGGCTGTCTCTGTCCTCTCGGCGAGAGACATC
TCGGCTGCTATGATGCGGCCGGCTGGGCCGCATACGCTCAATGCTCAGGCCTTTGACGCCACCGTCGAACTGATC
CGTCGAGTGTGCGAAGCTGGTGTCAATGTTCGCGAAATCTACGTCGATGCTGTTGGGCCTCCCGTTCCCTATCAG
GCCCGTCTTCAGCGTCTGTTTCCAACCGCCACCGTCGTCGTCGCCAACAAGGCTGATAGCCTGTATCCCTGCGTC
AGTGCTGCTTCCGTCTGCGCAAAGGTCACTCGTGACGCTGCCCTGGAGCATCTCTTCGCCGCTCGTGCTCCCAGC
TCCGGTTCCGGCCTGTCTTGGGGCTCTGGCTACCCGTCCGATGCCCGCTGCGTCGCCTGGATGAGGGCCAATCTG
CATCCCATCTTCGGTTGGGGTCCTGAATGTCGTTTCAGCTGGGGCACCGCCAAGGACATGCTCGACGGAAAGGCC
GCTGCCGTCAAGGTGGATTGGCCGCTGCCGCATGATGCCGACTCTCGCCGTCTGACCGACTATTTTCTGCCAAAC
GCCGACGAGAGGGGCTCGGACGAGCTGGGCTCCTGGTTCGGCACATCCGTGGGGCTGGAGGCCTTG
Transcript >Ophio5|5806
ATGGACGAGTCCGCCGTCGCCGCCGCCACCTTTGTCCCGCCGTCCATCCATGCCGACACCCTCGTCTCCGGCTCC
TCCTACACACACCTCTCCGACATCCCGCCCGCCCTCCTCGCCTCCCCTTCCCTGCCACCATGCGTCCTCGGTATC
GACGAAGCCGGTCGGGGTCCCGTGCTGGGCCCCATGGTCTACGCCGCCTTCGTCCTCCCCTCTTCGCTGTCGACG
ACGCTGCTCCGGGAGAAGTACGGCTTCGACGACTCCAAGGCGCTGACGCCCGCCCTTCGCACCCAGCTGATGCGC
TCCCTCTGCACCGCCGGCTCCGACCTTCACGACGTCTGCGCCTGGGCTGTCTCTGTCCTCTCGGCGAGAGACATC
TCGGCTGCTATGATGCGGCCGGCTGGGCCGCATACGCTCAATGCTCAGGCCTTTGACGCCACCGTCGAACTGATC
CGTCGAGTGTGCGAAGCTGGTGTCAATGTTCGCGAAATCTACGTCGATGCTGTTGGGCCTCCCGTTCCCTATCAG
GCCCGTCTTCAGCGTCTGTTTCCAACCGCCACCGTCGTCGTCGCCAACAAGGCTGATAGCCTGTATCCCTGCGTC
AGTGCTGCTTCCGTCTGCGCAAAGGTCACTCGTGACGCTGCCCTGGAGCATCTCTTCGCCGCTCGTGCTCCCAGC
TCCGGTTCCGGCCTGTCTTGGGGCTCTGGCTACCCGTCCGATGCCCGCTGCGTCGCCTGGATGAGGGCCAATCTG
CATCCCATCTTCGGTTGGGGTCCTGAATGTCGTTTCAGCTGGGGCACCGCCAAGGACATGCTCGACGGAAAGGCC
GCTGCCGTCAAGGTGGATTGGCCGCTGCCGCATGATGCCGACTCTCGCCGTCTGACCGACTATTTTCTGCCAAAC
GCCGACGAGAGGGGCTCGGACGAGCTGGGCTCCTGGTTCGGCACATCCGTGGGGCTGGAGGCCTTGTAG
Gene >Ophio5|5806
ATGGACGAGTCCGCCGTCGCCGCCGCCACCTTTGTCCCGCCGTCCATCCATGCCGACACCCTCGTCTCCGGCTCC
TCCTACACACACCTCTCCGACATCCCGCCCGCCCTCCTCGCCTCCCCTTCCCTGCCACCATGCGTCCTCGGTATC
GACGAAGCCGGTCGGGGTCCCGTGCTGGGCCCCATGGTCTACGCCGCCTTCGTCCTCCCCTCTTCGCTGTCGACG
ACGCTGCTCCGGGAGAAGTACGGCTTCGACGACTCCAAGGCGCTGACGCCCGCCCTTCGCACCCAGCTGATGCGC
TCCCTCTGCACCGCCGGCTCCGACCTTCACGACGTCTGCGCCTGGGCTGTCTCTGTCCTCTCGGCGAGAGACATC
TCGGCTGCTATGATGCGGCCGGCTGGGCCGCATACGCTCAATGCTCAGGCCTTTGACGCCACCGTCGAACTGATC
CGTCGAGTGTGCGAAGCTGGTGTCAATGTTCGCGAAATCTACGTCGATGCTGTTGGGCCTCCCGTTCCCTATCAG
GCCCGTCTTCAGCGTCTGTTTCCAACCGCCACCGTCGTCGTCGCCAACAAGGCTGATAGCCTGTATCCCTGCGTC
AGTGCTGCTTCCGTCTGCGCAAAGGTCACTCGTGACGCTGCCCTGGAGCATCTCTTCGCCGCTCGTGCTCCCAGC
TCCGGTTCCGGCCTGTCTTGGGGCTCTGGCTACCCGTCCGATGCCCGCTGCGTCGCCTGGATGAGGGCCAATCTG
CATCCCATCTTCGGTTGGGGTCCTGAATGTCGTTTCAGCTGGGGCACCGCCAAGGACATGCTCGACGGAAAGGCC
GCTGCCGTCAAGGTGGATTGGCCGCTGCCGCATGATGCCGACTCTCGCCGTCTGACCGACTATTTTCTGCCAAAC
GCCGACGAGAGGGGCTCGGACGAGCTGGGCTCCTGGTTCGGCACATCCGTGGGGCTGGAGGCCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail