Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5805
Gene name
Locationscaffold_487:7940..10743
Strand+
Gene length (bp)2803
Transcript length (bp)2574
Coding sequence length (bp)2571
Protein length (aa) 857

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20428 Sey1_3HB Sey1 three-helix bundle domain 5.0E-147 359 798
PF05879 RHD3_GTPase Root hair defective 3 GTP-binding protein (RHD3) GTPase domain 3.4E-124 58 312
PF02263 GBP Guanylate-binding protein, N-terminal domain 3.8E-08 54 143
PF01926 MMR_HSR1 50S ribosome-binding GTPase 9.6E-05 55 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CPP3|SEY1_ASPCL Protein sey1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sey1 PE=3 SV=2 17 854 0.0E+00
sp|B6QIM3|SEY1_TALMQ Protein sey1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sey1 PE=3 SV=2 2 856 0.0E+00
sp|A6R1D5|SEY1_AJECN Protein SEY1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|Q2UNK6|SEY1_ASPOR Protein sey1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sey1 PE=3 SV=2 2 854 0.0E+00
sp|B8MK20|SEY1_TALSN Protein sey1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sey1 PE=3 SV=1 2 856 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CPP3|SEY1_ASPCL Protein sey1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sey1 PE=3 SV=2 17 854 0.0E+00
sp|B6QIM3|SEY1_TALMQ Protein sey1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sey1 PE=3 SV=2 2 856 0.0E+00
sp|A6R1D5|SEY1_AJECN Protein SEY1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|Q2UNK6|SEY1_ASPOR Protein sey1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sey1 PE=3 SV=2 2 854 0.0E+00
sp|B8MK20|SEY1_TALSN Protein sey1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sey1 PE=3 SV=1 2 856 0.0E+00
sp|Q8TGG5|SEY1_ASPFU Protein sey1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sey1 PE=3 SV=1 2 855 0.0E+00
sp|B0XQZ0|SEY1_ASPFC Protein sey1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sey1 PE=3 SV=1 2 855 0.0E+00
sp|A1D2K1|SEY1_NEOFI Protein sey1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sey1 PE=3 SV=1 2 855 0.0E+00
sp|Q5BEE5|SEY1_EMENI Protein sey1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sey1 PE=3 SV=1 2 849 0.0E+00
sp|A2QR20|SEY1_ASPNC Protein sey1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sey1 PE=3 SV=1 2 854 0.0E+00
sp|Q0D0W7|SEY1_ASPTN Protein sey1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sey1 PE=3 SV=1 2 854 0.0E+00
sp|A8N5E5|SEY1_COPC7 Protein SEY1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEY1 PE=3 SV=1 15 821 0.0E+00
sp|Q4PEQ0|SEY1_USTMA Protein SEY1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEY1 PE=3 SV=2 23 808 0.0E+00
sp|B0D0N9|SEY1_LACBS Protein SEY1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=SEY1 PE=3 SV=1 23 830 0.0E+00
sp|P0CQ46|SEY1_CRYNJ Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SEY1 PE=3 SV=1 8 843 0.0E+00
sp|P0CQ47|SEY1_CRYNB Protein SEY1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SEY1 PE=3 SV=1 8 843 0.0E+00
sp|A8QAN4|SEY1_MALGO Protein SEY1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=SEY1 PE=3 SV=1 5 831 0.0E+00
sp|Q6C3B0|SEY1_YARLI Protein SEY1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEY1 PE=3 SV=1 22 839 0.0E+00
sp|Q2GUT7|SEY1_CHAGB Protein SEY1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEY1 PE=3 SV=2 1 855 0.0E+00
sp|B2W244|SEY1_PYRTR Protein sey1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sey1 PE=3 SV=2 1 855 0.0E+00
sp|B2B1M4|SEY1_PODAN Protein SEY1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SEY1 PE=3 SV=1 1 854 0.0E+00
sp|Q9P5X6|SEY1_NEUCR Protein sey1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sey1 PE=3 SV=1 1 845 0.0E+00
sp|Q525S7|SEY1_MAGO7 Protein SEY1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEY1 PE=3 SV=1 1 840 0.0E+00
sp|A7ERA6|SEY1_SCLS1 Protein sey1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sey1 PE=3 SV=1 1 855 0.0E+00
sp|A6S544|SEY1_BOTFB Protein sey1 OS=Botryotinia fuckeliana (strain B05.10) GN=sey1 PE=3 SV=1 1 847 0.0E+00
sp|B8NJL4|SEY1_ASPFN Protein sey1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sey1 PE=3 SV=1 2 854 0.0E+00
sp|Q0V302|SEY1_PHANO Protein SEY1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEY1 PE=3 SV=2 1 854 0.0E+00
sp|C5FJT2|SEY1_ARTOC Protein SEY1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SEY1 PE=3 SV=1 2 845 0.0E+00
sp|C4JQN4|SEY1_UNCRE Protein SEY1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SEY1 PE=3 SV=1 2 820 0.0E+00
sp|C5GMK3|SEY1_AJEDR Protein SEY1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|B6GX67|SEY1_PENRW Protein sey1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sey1 PE=3 SV=1 2 842 0.0E+00
sp|C0NJ57|SEY1_AJECG Protein SEY1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|Q1DL22|SEY1_COCIM Protein SEY1 OS=Coccidioides immitis (strain RS) GN=SEY1 PE=3 SV=1 2 829 0.0E+00
sp|C1GWM2|SEY1_PARBA Protein SEY1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SEY1 PE=3 SV=2 2 842 0.0E+00
sp|C1G4S9|SEY1_PARBD Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|C0S6S4|SEY1_PARBP Protein SEY1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|C5K3E1|SEY1_AJEDS Protein SEY1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SEY1 PE=3 SV=1 2 842 0.0E+00
sp|Q6BK59|SEY1_DEBHA Protein SEY1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEY1 PE=3 SV=2 20 851 2.0E-178
sp|C4Y2Z9|SEY1_CLAL4 Protein SEY1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=SEY1 PE=3 SV=1 22 813 6.0E-173
sp|C4R432|SEY1_PICPG Protein SEY1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEY1 PE=3 SV=1 22 817 6.0E-173
sp|A5DB26|SEY1_PICGU Protein SEY1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEY1 PE=3 SV=3 15 844 6.0E-169
sp|A3LWM9|SEY1_PICST Protein SEY1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEY1 PE=3 SV=2 22 827 4.0E-167
sp|C4YS65|SEY1_CANAW Protein SEY1 OS=Candida albicans (strain WO-1) GN=SEY1 PE=3 SV=1 22 813 4.0E-167
sp|B6K0N7|SEY1_SCHJY Protein sey1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=sey1 PE=3 SV=1 21 838 2.0E-166
sp|Q9C0L9|SEY1_CANAL Protein SEY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEY1 PE=1 SV=2 22 813 1.0E-165
sp|Q9UTE0|SEY1_SCHPO Protein sey1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sey1 PE=1 SV=1 22 809 1.0E-164
sp|B9WJF2|SEY1_CANDC Protein SEY1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SEY1 PE=3 SV=1 22 813 7.0E-163
sp|C5DEL5|SEY1_LACTC Protein SEY1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=SEY1 PE=3 SV=1 20 808 5.0E-159
sp|Q74ZD5|SEY1_ASHGO Protein SEY1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEY1 PE=3 SV=1 22 825 5.0E-158
sp|C5MCD3|SEY1_CANTT Protein SEY1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SEY1 PE=3 SV=2 22 813 3.0E-153
sp|A5E240|SEY1_LODEL Protein SEY1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEY1 PE=3 SV=1 22 813 1.0E-152
sp|Q99287|SEY1_YEAST Protein SEY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEY1 PE=1 SV=1 22 823 7.0E-152
sp|B5VS52|SEY1_YEAS6 Protein SEY1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SEY1 PE=3 SV=1 22 823 8.0E-152
sp|B3LJJ8|SEY1_YEAS1 Protein SEY1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SEY1 PE=3 SV=1 22 823 1.0E-151
sp|A6ZP10|SEY1_YEAS7 Protein SEY1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SEY1 PE=3 SV=1 22 823 7.0E-151
sp|Q6FLC5|SEY1_CANGA Protein SEY1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEY1 PE=3 SV=1 21 820 7.0E-146
sp|A7TJY3|SEY1_VANPO Protein SEY1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SEY1 PE=3 SV=1 17 830 2.0E-141
sp|C5DTA7|SEY1_ZYGRC Protein SEY1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SEY1 PE=3 SV=1 8 845 7.0E-137
sp|Q6CJ97|SEY1_KLULA Protein SEY1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEY1 PE=3 SV=1 22 824 1.0E-134
sp|Q54W90|SEY1_DICDI Protein SEY1 homolog OS=Dictyostelium discoideum GN=DDB_0206311 PE=3 SV=1 49 789 1.0E-106
sp|C4M6U3|SEY12_ENTHI Protein SEY1 homolog 2 OS=Entamoeba histolytica GN=EHI_054180 PE=3 SV=1 22 786 1.0E-103
sp|B0EKR0|SEY12_ENTDS Protein SEY1 homolog 2 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_026070 PE=3 SV=1 22 786 1.0E-96
sp|C4LTM1|SEY11_ENTHI Protein SEY1 homolog 1 OS=Entamoeba histolytica GN=EHI_012280 PE=3 SV=1 47 786 5.0E-83
sp|Q2QMH2|RHD31_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Oryza sativa subsp. japonica GN=Os12g0604600 PE=2 SV=1 22 770 9.0E-81
sp|B0E843|SEY11_ENTDS Protein SEY1 homolog 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EDI_213660 PE=3 SV=1 47 763 8.0E-80
sp|Q0JLS6|RHD3_ORYSJ Protein ROOT HAIR DEFECTIVE 3 OS=Oryza sativa subsp. japonica GN=RHD3 PE=2 SV=1 22 771 1.0E-79
sp|Q9SSN0|RHD31_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 1 OS=Arabidopsis thaliana GN=At1g72960 PE=2 SV=2 22 771 2.0E-78
sp|A2EI35|SEY11_TRIVA Protein SEY1 homolog 1 OS=Trichomonas vaginalis GN=TVAG_273580 PE=3 SV=1 24 807 6.0E-78
sp|A2FJ32|SEY13_TRIVA Protein SEY1 homolog 3 OS=Trichomonas vaginalis GN=TVAG_204380 PE=3 SV=1 24 843 3.0E-77
sp|A2EK80|SEY12_TRIVA Protein SEY1 homolog 2 OS=Trichomonas vaginalis GN=TVAG_100140 PE=3 SV=1 24 426 2.0E-72
sp|Q9FKE9|RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Arabidopsis thaliana GN=At5g45160 PE=2 SV=1 22 783 2.0E-72
sp|Q2R224|RHD32_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 2 OS=Oryza sativa subsp. japonica GN=Os11g0582300 PE=2 SV=1 14 773 2.0E-71
sp|P93042|RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3 OS=Arabidopsis thaliana GN=RHD3 PE=1 SV=1 22 771 9.0E-70
sp|Q8ILT5|SEY1_PLAF7 Protein SEY1 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0159 PE=3 SV=2 24 442 3.0E-61
sp|B3LAJ9|SEY1_PLAKH Protein SEY1 homolog OS=Plasmodium knowlesi (strain H) GN=PKH_133110 PE=3 SV=1 20 422 5.0E-60
sp|Q4XZY3|SEY1_PLACH Protein SEY1 homolog OS=Plasmodium chabaudi GN=PC000321.02.0 PE=3 SV=1 24 331 5.0E-59
sp|A5K168|SEY1_PLAVS Protein SEY1 homolog OS=Plasmodium vivax (strain Salvador I) GN=PVX_085645 PE=3 SV=1 20 331 5.0E-59
sp|A7AT07|SEY1_BABBO Protein SEY1 homolog OS=Babesia bovis GN=BBOV_II001090 PE=3 SV=1 16 785 3.0E-58
sp|Q4U9I8|SEY1_THEAN Protein SEY1 homolog OS=Theileria annulata GN=TA08650 PE=3 SV=1 33 787 3.0E-58
sp|A4HK17|SEY1_LEIBR Protein SEY1 homolog OS=Leishmania braziliensis GN=LbrM32_V2.0440 PE=3 SV=2 49 405 7.0E-57
sp|Q4DHA1|SEY1_TRYCC Protein SEY1 homolog OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511285.50 PE=3 SV=1 48 344 3.0E-54
sp|Q388F1|SEY1_TRYB2 Protein SEY1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.61.2200 PE=3 SV=1 49 323 3.0E-54
sp|Q4Q5P8|SEY1_LEIMA Protein SEY1 homolog OS=Leishmania major GN=LmjF32.0370 PE=3 SV=2 49 344 6.0E-54
sp|A4I7K1|SEY1_LEIIN Protein SEY1 homolog OS=Leishmania infantum GN=LinJ32.0740 PE=3 SV=2 49 325 6.0E-53
sp|Q4N280|SEY1_THEPA Protein SEY1 homolog OS=Theileria parva GN=TP04_0477 PE=3 SV=2 33 415 2.0E-51
sp|A0BKG2|SEY11_PARTE Protein SEY1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00029660001 PE=3 SV=1 28 800 4.0E-44
sp|A0E2L1|SEY12_PARTE Protein SEY1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00022700001 PE=3 SV=1 28 800 3.0E-39
sp|Q5CL93|SEY1_CRYHO Protein SEY1 homolog OS=Cryptosporidium hominis GN=Chro.80282 PE=3 SV=1 24 331 7.0E-38
sp|A8BW14|SEY1_GIAIC Protein SEY1 homolog OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_32509 PE=3 SV=1 37 334 2.0E-34
sp|Q80SU7|GVIN1_MOUSE Interferon-induced very large GTPase 1 OS=Mus musculus GN=Gvin1 PE=1 SV=1 54 186 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 735 757 22
2 764 786 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5805
MNGHFSAVGDQLRGNNNSFDHGVQVVDEDKAFNSNVSEYLRVCHVAEAGFNYHLISVFGSQSTGKSTLLNHLFGT
DFSVMSETERRQTTKGIWMAKNKRPNMADNILVMDVEGTDGRERGEDQDFERKSALFALATSEVLLVNIWEHQVG
LYQGANMGLLKTVFEVNLQLFLKDKQSTPRSLLFFVIRDHIGTTPLSNLRTTLTQDLTKIWSTIAKPEGLEGSRI
EDYFDFAFAALPHKILQEEKFRSDVRDLGSRFVSGHRVGKPGSHGDQELEGGVFLPEYHRRIPADGLSVYAEGIW
DQIVHNKDLDLPTQQELLAQFRCDEISRDVLVAFDLLVVPLEERQSEATKLGRALVLADLGATGSKARFECVKAF
EAQAGRYHKATFSRKKQELEAKVDTRLKALYQGQLAAAHKSGVAAFSEAVTNKVKAGQKAGGGYDFADIVAQEKK
KTLEEFEAEATGLAMRGVAWTDFKPQCQLFETELDEVSARLRKEEMRRLATRVERWVRSRLADDVGLEFNKLGSG
RGGSGAPEEGEMPETEKDLWDRIWTVFTGVVAEAESRFAERARSFDASSDEVEVGMWRLRRKSWVGLREKIEEEV
MEGNILLKLRENFEDKFRYDEAGVPRIWRPSDDIEGLYTKARESTLTLIPLLSRFRLSETYAPPDLPDFVGTQPR
GVEAGDEEDLAPIGGVDEDEGKSLEEEMTVLSESKRQDLVVRFKKTADGVYVEAKRSAIGGVAQVPWYFYALLMA
LGWNEFYMVLRNPFLFILMLMMAGGTYVAYTLNLLGPMIQMGNAAVNQGVDIAKQQLRDFIVNSEAAKQALAMPA
SNGSSATDTRMDELNRRGKKMSPEAEEEDENF
Coding >Ophio5|5805
ATGAACGGCCACTTTTCCGCCGTCGGCGACCAGTTACGGGGCAACAACAACAGCTTCGATCATGGCGTCCAGGTT
GTCGACGAGGACAAGGCCTTCAATTCCAACGTGAGCGAGTACCTACGCGTCTGTCACGTCGCTGAGGCTGGCTTC
AACTACCATCTCATCTCCGTCTTCGGCTCCCAGTCGACGGGCAAGTCGACGCTGCTCAACCATCTCTTTGGCACA
GATTTTTCCGTCATGTCTGAGACGGAGCGCCGACAGACGACAAAGGGCATCTGGATGGCTAAGAATAAGCGCCCC
AACATGGCCGACAACATCCTCGTCATGGACGTCGAGGGCACAGACGGTCGCGAACGTGGCGAGGACCAGGACTTT
GAGCGGAAAAGTGCCCTGTTTGCTCTCGCTACCAGCGAAGTCCTTCTCGTCAATATCTGGGAGCACCAGGTCGGC
CTCTACCAGGGCGCCAACATGGGCTTGCTCAAGACTGTCTTCGAGGTCAACCTGCAGCTCTTCCTCAAGGACAAG
CAGTCTACGCCGAGATCGCTCCTCTTCTTCGTCATCCGCGACCACATCGGCACGACGCCGCTGTCCAACCTGCGC
ACCACCCTGACTCAAGACTTGACCAAGATTTGGTCTACCATCGCCAAGCCCGAGGGACTGGAGGGCTCTCGCATA
GAAGACTACTTCGACTTTGCCTTTGCCGCCCTCCCTCATAAGATCCTCCAGGAGGAAAAGTTCCGCTCCGACGTT
CGAGACCTCGGCTCACGTTTCGTCTCCGGTCATAGAGTTGGCAAGCCGGGCAGCCACGGCGATCAGGAGCTCGAA
GGCGGCGTCTTCCTACCCGAGTACCACCGACGGATCCCCGCCGACGGGCTCTCCGTCTACGCCGAGGGCATCTGG
GACCAGATCGTGCACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTTCGGTGCGACGAG
ATCTCGCGCGACGTCTTGGTCGCCTTTGACCTCCTCGTCGTGCCCCTCGAGGAGCGGCAGAGCGAGGCCACGAAG
CTGGGCAGGGCCCTGGTCTTGGCCGACCTGGGTGCCACCGGGAGCAAGGCACGCTTCGAGTGCGTCAAGGCCTTT
GAGGCGCAGGCCGGCCGCTACCACAAGGCGACCTTTTCGCGTAAGAAGCAGGAGCTCGAGGCCAAGGTCGACACG
CGGCTCAAGGCCCTCTACCAGGGCCAGCTCGCTGCTGCTCACAAGTCAGGAGTCGCTGCCTTTAGCGAGGCCGTC
ACCAACAAGGTCAAGGCAGGACAAAAGGCCGGTGGCGGCTACGACTTTGCCGACATCGTGGCCCAAGAGAAGAAG
AAGACGCTCGAAGAATTCGAGGCCGAAGCCACGGGGTTGGCGATGCGGGGCGTGGCGTGGACCGACTTCAAGCCT
CAGTGCCAGCTGTTCGAGACGGAGCTGGACGAGGTGAGCGCCCGGCTGCGCAAGGAGGAGATGCGGCGGCTGGCT
ACGCGGGTCGAGCGCTGGGTCAGGTCACGGCTCGCCGACGACGTCGGCCTCGAGTTCAACAAGCTCGGCTCCGGC
AGAGGCGGCTCCGGCGCGCCCGAGGAGGGGGAGATGCCGGAGACGGAGAAGGACCTCTGGGATAGGATCTGGACC
GTCTTCACCGGCGTCGTCGCCGAGGCCGAGAGCCGCTTCGCCGAGCGGGCCCGGAGTTTCGATGCCAGCAGCGAC
GAGGTCGAGGTGGGCATGTGGCGCCTCCGCCGCAAGAGCTGGGTCGGGTTGCGGGAGAAGATTGAGGAGGAGGTC
ATGGAGGGCAACATCCTCCTCAAGTTGCGGGAGAACTTTGAGGACAAGTTCCGGTACGACGAGGCGGGCGTTCCG
CGGATATGGCGCCCCAGCGACGACATCGAGGGCCTGTACACCAAGGCGCGAGAGTCGACGCTAACGCTGATCCCG
CTGCTCTCCCGCTTCCGGCTTTCGGAGACGTACGCGCCGCCGGACCTGCCGGACTTTGTCGGGACGCAGCCCCGG
GGCGTCGAGGCCGGCGACGAGGAGGACCTGGCGCCCATCGGCGGCGTGGACGAGGACGAGGGCAAGAGCCTAGAG
GAGGAGATGACGGTGCTCAGCGAGTCCAAGAGGCAGGATCTGGTGGTGCGTTTCAAGAAGACGGCTGACGGGGTC
TACGTCGAGGCCAAGCGCAGCGCCATCGGCGGCGTGGCGCAGGTGCCATGGTATTTCTACGCCCTGCTCATGGCG
CTTGGCTGGAACGAGTTTTATATGGTGCTGAGGAACCCGTTCCTTTTCATCCTGATGCTGATGATGGCCGGCGGC
ACCTACGTTGCCTACACGCTCAACCTGCTGGGCCCCATGATACAGATGGGCAACGCGGCCGTCAACCAGGGCGTC
GACATCGCCAAGCAGCAGCTGCGCGACTTCATTGTCAACTCGGAGGCGGCGAAGCAGGCGCTGGCCATGCCGGCG
TCCAACGGCTCGAGCGCGACGGATACGCGCATGGATGAGCTGAATAGGCGAGGGAAGAAGATGTCACCGGAGGCG
GAGGAGGAGGATGAGAACTTT
Transcript >Ophio5|5805
ATGAACGGCCACTTTTCCGCCGTCGGCGACCAGTTACGGGGCAACAACAACAGCTTCGATCATGGCGTCCAGGTT
GTCGACGAGGACAAGGCCTTCAATTCCAACGTGAGCGAGTACCTACGCGTCTGTCACGTCGCTGAGGCTGGCTTC
AACTACCATCTCATCTCCGTCTTCGGCTCCCAGTCGACGGGCAAGTCGACGCTGCTCAACCATCTCTTTGGCACA
GATTTTTCCGTCATGTCTGAGACGGAGCGCCGACAGACGACAAAGGGCATCTGGATGGCTAAGAATAAGCGCCCC
AACATGGCCGACAACATCCTCGTCATGGACGTCGAGGGCACAGACGGTCGCGAACGTGGCGAGGACCAGGACTTT
GAGCGGAAAAGTGCCCTGTTTGCTCTCGCTACCAGCGAAGTCCTTCTCGTCAATATCTGGGAGCACCAGGTCGGC
CTCTACCAGGGCGCCAACATGGGCTTGCTCAAGACTGTCTTCGAGGTCAACCTGCAGCTCTTCCTCAAGGACAAG
CAGTCTACGCCGAGATCGCTCCTCTTCTTCGTCATCCGCGACCACATCGGCACGACGCCGCTGTCCAACCTGCGC
ACCACCCTGACTCAAGACTTGACCAAGATTTGGTCTACCATCGCCAAGCCCGAGGGACTGGAGGGCTCTCGCATA
GAAGACTACTTCGACTTTGCCTTTGCCGCCCTCCCTCATAAGATCCTCCAGGAGGAAAAGTTCCGCTCCGACGTT
CGAGACCTCGGCTCACGTTTCGTCTCCGGTCATAGAGTTGGCAAGCCGGGCAGCCACGGCGATCAGGAGCTCGAA
GGCGGCGTCTTCCTACCCGAGTACCACCGACGGATCCCCGCCGACGGGCTCTCCGTCTACGCCGAGGGCATCTGG
GACCAGATCGTGCACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTTCGGTGCGACGAG
ATCTCGCGCGACGTCTTGGTCGCCTTTGACCTCCTCGTCGTGCCCCTCGAGGAGCGGCAGAGCGAGGCCACGAAG
CTGGGCAGGGCCCTGGTCTTGGCCGACCTGGGTGCCACCGGGAGCAAGGCACGCTTCGAGTGCGTCAAGGCCTTT
GAGGCGCAGGCCGGCCGCTACCACAAGGCGACCTTTTCGCGTAAGAAGCAGGAGCTCGAGGCCAAGGTCGACACG
CGGCTCAAGGCCCTCTACCAGGGCCAGCTCGCTGCTGCTCACAAGTCAGGAGTCGCTGCCTTTAGCGAGGCCGTC
ACCAACAAGGTCAAGGCAGGACAAAAGGCCGGTGGCGGCTACGACTTTGCCGACATCGTGGCCCAAGAGAAGAAG
AAGACGCTCGAAGAATTCGAGGCCGAAGCCACGGGGTTGGCGATGCGGGGCGTGGCGTGGACCGACTTCAAGCCT
CAGTGCCAGCTGTTCGAGACGGAGCTGGACGAGGTGAGCGCCCGGCTGCGCAAGGAGGAGATGCGGCGGCTGGCT
ACGCGGGTCGAGCGCTGGGTCAGGTCACGGCTCGCCGACGACGTCGGCCTCGAGTTCAACAAGCTCGGCTCCGGC
AGAGGCGGCTCCGGCGCGCCCGAGGAGGGGGAGATGCCGGAGACGGAGAAGGACCTCTGGGATAGGATCTGGACC
GTCTTCACCGGCGTCGTCGCCGAGGCCGAGAGCCGCTTCGCCGAGCGGGCCCGGAGTTTCGATGCCAGCAGCGAC
GAGGTCGAGGTGGGCATGTGGCGCCTCCGCCGCAAGAGCTGGGTCGGGTTGCGGGAGAAGATTGAGGAGGAGGTC
ATGGAGGGCAACATCCTCCTCAAGTTGCGGGAGAACTTTGAGGACAAGTTCCGGTACGACGAGGCGGGCGTTCCG
CGGATATGGCGCCCCAGCGACGACATCGAGGGCCTGTACACCAAGGCGCGAGAGTCGACGCTAACGCTGATCCCG
CTGCTCTCCCGCTTCCGGCTTTCGGAGACGTACGCGCCGCCGGACCTGCCGGACTTTGTCGGGACGCAGCCCCGG
GGCGTCGAGGCCGGCGACGAGGAGGACCTGGCGCCCATCGGCGGCGTGGACGAGGACGAGGGCAAGAGCCTAGAG
GAGGAGATGACGGTGCTCAGCGAGTCCAAGAGGCAGGATCTGGTGGTGCGTTTCAAGAAGACGGCTGACGGGGTC
TACGTCGAGGCCAAGCGCAGCGCCATCGGCGGCGTGGCGCAGGTGCCATGGTATTTCTACGCCCTGCTCATGGCG
CTTGGCTGGAACGAGTTTTATATGGTGCTGAGGAACCCGTTCCTTTTCATCCTGATGCTGATGATGGCCGGCGGC
ACCTACGTTGCCTACACGCTCAACCTGCTGGGCCCCATGATACAGATGGGCAACGCGGCCGTCAACCAGGGCGTC
GACATCGCCAAGCAGCAGCTGCGCGACTTCATTGTCAACTCGGAGGCGGCGAAGCAGGCGCTGGCCATGCCGGCG
TCCAACGGCTCGAGCGCGACGGATACGCGCATGGATGAGCTGAATAGGCGAGGGAAGAAGATGTCACCGGAGGCG
GAGGAGGAGGATGAGAACTTTTGA
Gene >Ophio5|5805
ATGAACGGCCACTTTTCCGCCGTCGGCGACCAGTTACGGGGCAACAACAACAGCTTCGATCATGGCGTCCAGGTT
GTCGACGAGGACAAGGCCTTCAAGTACGTGAGACGACGTTGCTAAACCCTCCCCCGAAATTTCCGTCCATTTCGC
TGGCTGACGATGGGATATAACTACCTACCTAGTTCCAACGTGAGCGAGTACCTACGCGTCTGTCACGTCGCTGAG
GCTGGCTTCAACTACCATCTCATCTCCGTCTTCGGCTCCCAGTCGACGGGCAAGTCGACGCTGCTCAACCATCTC
TTTGGCACAGATTTTTCCGTCATGTCTGAGACGGAGCGCCGACAGACGACAAAGGGCATCTGGATGGCTAAGAAT
AAGCGCCCCAACATGGCCGACAACATCCTCGTCATGGACGTCGAGGGCACAGACGGTCGCGAACGTGGCGAGGAC
CAGGACTTTGAGCGGAAAAGTGCCCTGTTTGCTCTCGCTACCAGCGAAGTCCTTCTCGTCAATATCTGGGAGCAC
CAGGTCGGCCTCTACCAGGGCGCCAACATGGGCTTGCTCAAGACTGTCTTCGAGGTCAACCTGCAGCTCTTCCTC
AAGGACAAGCAGTAGGGGAAACGTTTTTTTTTTCTTTCTTTTCATTAGCTTTCTTTGTAGGCTGACCCGCTCTTC
GATTCAACCAGGTCTACGCCGAGATCGCTCCTCTTCTTCGTCATCCGCGACCACATCGGCACGACGCCGCTGTCC
AACCTGCGCACCACCCTGACTCAAGACTTGACCAAGATTTGGTCTACCATCGCCAAGCCCGAGGGACTGGAGGGC
TCTCGCATAGAAGACTACTTCGACTTTGCCTTTGCCGCCCTCCCTCATAAGATCCTCCAGGAGGAAAAGTTCCGC
TCCGACGTTCGAGACCTCGGCTCACGTTTCGTCTCCGGTCATAGAGTTGGCAAGCCGGGCAGCCACGGCGATCAG
GAGCTCGAAGGCGGCGTCTTCCTACCCGAGTACCACCGACGGATCCCCGCCGACGGGCTCTCCGTCTACGCCGAG
GGCATCTGGGACCAGATCGTGCACAACAAGGATCTCGACCTGCCCACCCAGCAGGAGCTCCTGGCCCAGTTTCGG
TGCGACGAGATCTCGCGCGACGTCTTGGTCGCCTTTGACCTCCTCGTCGTGCCCCTCGAGGAGCGGCAGAGCGAG
GCCACGAAGCTGGGCAGGGCCCTGGTCTTGGCCGACCTGGGTGCCACCGGGAGCAAGGCACGCTTCGAGTGCGTC
AAGGCCTTTGAGGCGCAGGCCGGCCGCTACCACAAGGCGACCTTTTCGCGTAAGAAGCAGGAGCTCGAGGCCAAG
GTCGACACGCGGCTCAAGGCCCTCTACCAGGGCCAGCTCGCTGCTGCTCACAAGTCAGGAGTCGCTGCCTTTAGC
GAGGCCGTCACCAACAAGGTCAAGGCAGGACAAAAGGCCGGTGGCGGCTACGACTTTGCCGACATCGTGGCCCAA
GAGAAGAAGAAGACGCTCGAAGAATTCGAGGCCGAAGCCACGGGGTTGGCGATGCGGGGCGTGGCGTGGACCGAC
TTCAAGCCTCAGTGCCAGCTGTTCGAGACGGAGCTGGACGAGGTGAGCGCCCGGCTGCGCAAGGAGGAGATGCGG
CGGCTGGCTACGCGGGTCGAGCGCTGGGTCAGGTCACGGCTCGCCGACGACGTCGGCCTCGAGTTCAACAAGCTC
GGCTCCGGCAGAGGCGGCTCCGGCGCGCCCGAGGAGGGGGAGATGCCGGAGACGGAGAAGGACCTCTGGGATAGG
ATCTGGACCGTCTTCACCGGCGTCGTCGCCGAGGCCGAGAGCCGCTTCGCCGAGCGGGCCCGGAGTTTCGATGCC
AGCAGCGACGAGGTCGAGGTGGGCATGTGGCGCCTCCGCCGCAAGAGCTGGGTCGGGTTGCGGGAGAAGATTGAG
GAGGAGGTCATGGAGGGCAACATCCTCCTCAAGTTGCGGGAGAACTTTGAGGACAAGTTCCGGTACGACGAGGCG
GGCGTTCCGCGGATATGGCGCCCCAGCGACGACATCGAGGGCCTGTACACCAAGGCGCGAGAGTCGACGCTAACG
CTGATCCCGCTGCTCTCCCGCTTCCGGCTTTCGGAGACGTACGCGCCGCCGGACCTGCCGGACTTTGTCGGGACG
CAGCCCCGGGGCGTCGAGGCCGGCGACGAGGAGGACCTGGCGCCCATCGGCGGCGTGGACGAGGACGAGGGCAAG
AGCCTAGAGGAGGAGATGACGGTGCTCAGCGAGTCCAAGAGGCAGGATCTGGTGGTGCGTTTCAAGAAGACGGCT
GACGGGGTCTACGTCGAGGCCAAGCGCAGCGCCATCGGCGGCGTGGCGCAGGTGCCATGGTATTTCTACGCCCTG
CTCATGGCGCTTGGCTGGAACGAGTTTTATATGGGTGAGTTCTCGAGAAAAGAAAAGGACAAGGTGAGGGAACGC
TTGGCTGACCACGCCTCGTCTCTCTCCAGTGCTGAGGAACCCGTTCCTTTTCATCCTGATGCTGATGATGGCCGG
CGGCACCTACGTTGCCTACACGCTCAACCTGCTGGGCCCCATGATACAGATGGGCAACGCGGCCGTCAACCAGGG
CGTCGACATCGCCAAGCAGCAGCTGCGCGACTTCATTGTCAACTCGGAGGCGGCGAAGCAGGCGCTGGCCATGCC
GGCGTCCAACGGCTCGAGCGCGACGGATACGCGCATGGATGAGCTGAATAGGCGAGGGAAGAAGATGTCACCGGA
GGCGGAGGAGGAGGATGAGAACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail