Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5795
Gene name
Locationscaffold_486:1859..3092
Strand-
Gene length (bp)1233
Transcript length (bp)783
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.6E-13 94 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AZC5|CFMA_ARTBC GPI-anchored CFEM domain protein ARB_01545 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01545 PE=1 SV=2 81 165 5.0E-08
sp|Q4WLB9|CFMA_ASPFU GPI-anchored CFEM domain protein A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfmA PE=1 SV=1 99 144 5.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1521 0.1542 0.7789 0.261 0.0932 0.0191 0.171 0.0975 0.115 0.0044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1045
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3793
Ophiocordyceps australis map64 (Brazil) OphauB2|1010
Ophiocordyceps camponoti-floridani Ophcf2|05694
Ophiocordyceps camponoti-rufipedis Ophun1|2070
Ophiocordyceps kimflemingae Ophio5|3256
Ophiocordyceps kimflemingae Ophio5|5795 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9741

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5795
MMRTCLASPDKSPRFAALEINSSSHTLSFLSPFTCILKQPVISESFASASPPSRSHQLALFASLRPPTNSQFFNL
SVKMKSAVFAVSLAAAVAAQGLPQCPTNCLNSMNTEKAKGLGCENNDFKCLCTKQDWVFGIRDCVAQACNNGQQV
VDALNDAKNTCAQNGIQIDVNGINTSAGGPTNTGVVVAPPVETVATVFSTFSSGGSLASTPLVTTTIGTETTTTV
TAGSTTSTSRGFAAQVTAAPAAGVLAAAGLAALMI
Coding >Ophio5|5795
ATGATGCGCACCTGCCTTGCTTCGCCAGATAAATCTCCTCGCTTCGCCGCCCTCGAAATCAATTCTTCATCCCAC
ACACTTTCATTCCTCTCTCCATTCACCTGCATCCTCAAGCAACCAGTTATCTCTGAGTCTTTTGCCTCTGCATCA
CCTCCCTCTCGCTCTCATCAACTCGCACTCTTTGCCTCTCTTCGCCCACCGACAAACAGTCAATTTTTTAATCTC
TCAGTCAAAATGAAGTCCGCTGTCTTTGCCGTCTCTCTGGCTGCTGCCGTTGCCGCTCAGGGCCTTCCTCAGTGC
CCTACGAACTGCCTCAACAGCATGAACACGGAGAAGGCTAAGGGCCTGGGCTGCGAAAACAACGACTTCAAGTGC
CTCTGCACCAAGCAGGACTGGGTCTTCGGCATCCGCGACTGCGTTGCCCAGGCCTGCAACAACGGCCAGCAGGTC
GTCGACGCCCTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTATTCAGATCGATGTCAACGGCATCAACACC
TCCGCCGGTGGCCCCACTAACACTGGTGTTGTCGTCGCTCCCCCCGTCGAGACCGTTGCCACCGTTTTCAGCACC
TTCTCTTCCGGTGGCTCGCTCGCTTCGACGCCTCTCGTCACCACCACGATTGGTACTGAGACCACCACCACGGTC
ACTGCCGGCTCGACGACCTCCACCAGCCGTGGCTTCGCCGCTCAGGTGACGGCCGCCCCCGCCGCCGGCGTGCTC
GCCGCCGCCGGTCTCGCCGCCCTCATGATC
Transcript >Ophio5|5795
ATGATGCGCACCTGCCTTGCTTCGCCAGATAAATCTCCTCGCTTCGCCGCCCTCGAAATCAATTCTTCATCCCAC
ACACTTTCATTCCTCTCTCCATTCACCTGCATCCTCAAGCAACCAGTTATCTCTGAGTCTTTTGCCTCTGCATCA
CCTCCCTCTCGCTCTCATCAACTCGCACTCTTTGCCTCTCTTCGCCCACCGACAAACAGTCAATTTTTTAATCTC
TCAGTCAAAATGAAGTCCGCTGTCTTTGCCGTCTCTCTGGCTGCTGCCGTTGCCGCTCAGGGCCTTCCTCAGTGC
CCTACGAACTGCCTCAACAGCATGAACACGGAGAAGGCTAAGGGCCTGGGCTGCGAAAACAACGACTTCAAGTGC
CTCTGCACCAAGCAGGACTGGGTCTTCGGCATCCGCGACTGCGTTGCCCAGGCCTGCAACAACGGCCAGCAGGTC
GTCGACGCCCTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTATTCAGATCGATGTCAACGGCATCAACACC
TCCGCCGGTGGCCCCACTAACACTGGTGTTGTCGTCGCTCCCCCCGTCGAGACCGTTGCCACCGTTTTCAGCACC
TTCTCTTCCGGTGGCTCGCTCGCTTCGACGCCTCTCGTCACCACCACGATTGGTACTGAGACCACCACCACGGTC
ACTGCCGGCTCGACGACCTCCACCAGCCGTGGCTTCGCCGCTCAGGTGACGGCCGCCCCCGCCGCCGGCGTGCTC
GCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG
Gene >Ophio5|5795
ATGATGCGCACCTGCCTTGCTTCGCCAGATAAATCTCCTCGCTTCGCCGCCCTCGAAATCAATTCTTCATCCCAC
ACACTTTCATTCCTCTCTCCATTCACCTGCATCCTCAAGCAACCAGTTATCTCTGAGTCTTTTGCCTCTGCATCA
CCTCCCTCTCGCTCTCATCAACTCGCACTCTTTGCCTCTCTTCGCCCACCGACAAACAGGTCAGTCCTTCCTGAT
TCCCCATCATCAGATTTTTCTCTTTCCCCCATCGCTTTTCATCGCCTTCACATCGCCACTCCCTGTCCTGCCTTC
TCCCGCACACTTCCATCTCGCCTTGCCCTCGCCTCTGATTCACGGGCTGGCCGGCTTTCGACGACTCATCGTCAT
CAGCACAAGCCTTCACCTCCCACATTCCCCCTCCCCATTTCTTATCCTCTTCTCACGCTTCTTCGCCCACTCGAC
GCGTCACCACCTCATTCTTCTCGTACTGACTCGACTTCTACTCCCTCAGTCAATTTTTTAATCTCTCAGTCAAAA
TGAAGTCCGCTGTCTTTGCCGTCTCTCTGGCTGCTGCCGTTGCCGCTCAGGGCCTTCCTCAGTGCCCTGTAGGTC
GCCTCTATTGGGGAGCTCACCATCCGCCCTACTGACAACCGCCTTCAGACGAACTGCCTCAACAGCATGAACACG
GAGAAGGCTAAGGGCCTGGGCTGCGAAAACAACGACTTCAAGTGCCTCTGCACCAAGCAGGACTGGGTCTTCGGC
ATCCGCGACTGCGTTGCCCAGGCCTGCAACAACGGCCAGCAGGTCGTCGACGCCCTCAACGACGCCAAGAACACC
TGCGCCCAGAACGGTATTCAGATCGATGTCAACGGCATCAACACCTCCGCCGGTGGCCCCACTGTATGTCGATGC
CGCGACGGGCCGACGATTTCCTAGCTGACGAGATGAAAGAACACTGGTGTTGTCGTCGCTCCCCCCGTCGAGACC
GTTGCCACCGTTTTCAGCACCTTCTCTTCCGGTGGCTCGCTCGCTTCGACGCCTCTCGTCACCACCACGATTGGT
ACTGAGACCACCACCACGGTCACTGCCGGCTCGACGACCTCCACCAGCCGTGGCTTCGCCGTAAGTGCCCCAATA
GCGACTTGACAAGACTCAGCGCTGACGCGGACTCAACAGGCTCAGGTGACGGCCGCCCCCGCCGCCGGCGTGCTC
GCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail