Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5791
Gene name
Locationscaffold_485:9768..10421
Strand-
Gene length (bp)653
Transcript length (bp)432
Coding sequence length (bp)429
Protein length (aa) 143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01125 G10 G10 protein 9.7E-58 1 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74772|CWF14_SCHPO Pre-mRNA-splicing factor cwf14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf14 PE=1 SV=1 1 140 8.0E-51
sp|Q962X9|BUD31_BRABE Protein BUD31 homolog OS=Branchiostoma belcheri PE=2 SV=1 1 140 4.0E-50
sp|P25337|BUD31_YEAST Pre-mRNA-splicing factor BUD31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD31 PE=1 SV=1 1 140 1.0E-47
sp|P12805|BUD31_XENLA Protein BUD31 homolog OS=Xenopus laevis GN=bud31 PE=2 SV=1 1 140 3.0E-47
sp|Q567Z7|BUD31_DANRE Protein BUD31 homolog OS=Danio rerio GN=bud31 PE=2 SV=1 1 140 4.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74772|CWF14_SCHPO Pre-mRNA-splicing factor cwf14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf14 PE=1 SV=1 1 140 8.0E-51
sp|Q962X9|BUD31_BRABE Protein BUD31 homolog OS=Branchiostoma belcheri PE=2 SV=1 1 140 4.0E-50
sp|P25337|BUD31_YEAST Pre-mRNA-splicing factor BUD31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD31 PE=1 SV=1 1 140 1.0E-47
sp|P12805|BUD31_XENLA Protein BUD31 homolog OS=Xenopus laevis GN=bud31 PE=2 SV=1 1 140 3.0E-47
sp|Q567Z7|BUD31_DANRE Protein BUD31 homolog OS=Danio rerio GN=bud31 PE=2 SV=1 1 140 4.0E-47
sp|O70454|BUD31_RAT Protein BUD31 homolog OS=Rattus norvegicus GN=Bud31 PE=2 SV=2 1 140 2.0E-46
sp|P41223|BUD31_HUMAN Protein BUD31 homolog OS=Homo sapiens GN=BUD31 PE=1 SV=2 1 140 2.0E-46
sp|Q2NKU3|BUD31_BOVIN Protein BUD31 homolog OS=Bos taurus GN=BUD31 PE=2 SV=1 1 140 2.0E-46
sp|P34313|BUD31_CAEEL Protein BUD31 homolog OS=Caenorhabditis elegans GN=C07A9.2 PE=2 SV=1 10 140 4.0E-46
sp|Q65WT0|BD31B_ORYSJ Protein BUD31 homolog 2 OS=Oryza sativa subsp. japonica GN=Os05g0446300 PE=2 SV=1 1 140 6.0E-44
sp|P35682|BD31C_ORYSJ Protein BUD31 homolog 3 OS=Oryza sativa subsp. japonica GN=Os12g0149800 PE=2 SV=2 1 140 4.0E-43
sp|Q94DE2|BD31A_ORYSJ Protein BUD31 homolog 1 OS=Oryza sativa subsp. japonica GN=Os01g0857700 PE=2 SV=1 1 140 9.0E-43
sp|Q6PGH1|BUD31_MOUSE Protein BUD31 homolog OS=Mus musculus GN=Bud31 PE=1 SV=1 70 140 3.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5115 0.6106 0.0984 0.1292 0.3872 0.042 0.0462 0.1078 0.0393 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5140
Ophiocordyceps australis map64 (Brazil) OphauB2|6178
Ophiocordyceps camponoti-floridani Ophcf2|05000
Ophiocordyceps camponoti-rufipedis Ophun1|4519
Ophiocordyceps kimflemingae Ophio5|5791 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8651

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5791
MPAIRHASKRKPPPEGFSDIEDDLLIFANKMKDAHNKPPPPGPKHQAQWEVFQISHQRSRYIYDLYYEKEAISKD
LYDWLLKNGYADAMLIAKWKKQGYEKLCCLRCVQTKETSFNSTCICRVPRAQLKEDRDLQCVNCGYVL
Coding >Ophio5|5791
ATGCCCGCAATACGCCACGCATCCAAGAGGAAGCCTCCCCCCGAGGGCTTCAGCGACATTGAGGATGACCTTTTG
ATCTTCGCGAACAAGATGAAAGATGCGCACAACAAGCCGCCGCCGCCAGGACCCAAACATCAAGCCCAGTGGGAA
GTCTTCCAGATCTCGCACCAAAGGAGCCGCTATATATACGATCTTTACTACGAGAAAGAGGCTATTAGCAAGGAT
TTATACGACTGGCTTTTGAAGAACGGTTACGCAGACGCCATGCTGATCGCGAAATGGAAGAAGCAAGGATACGAA
AAGCTTTGCTGCCTCCGCTGTGTCCAGACAAAGGAAACCAGCTTCAACAGCACATGCATCTGTCGCGTTCCCCGG
GCCCAACTCAAGGAGGACCGAGATCTTCAATGTGTCAACTGCGGCTACGTTCTG
Transcript >Ophio5|5791
ATGCCCGCAATACGCCACGCATCCAAGAGGAAGCCTCCCCCCGAGGGCTTCAGCGACATTGAGGATGACCTTTTG
ATCTTCGCGAACAAGATGAAAGATGCGCACAACAAGCCGCCGCCGCCAGGACCCAAACATCAAGCCCAGTGGGAA
GTCTTCCAGATCTCGCACCAAAGGAGCCGCTATATATACGATCTTTACTACGAGAAAGAGGCTATTAGCAAGGAT
TTATACGACTGGCTTTTGAAGAACGGTTACGCAGACGCCATGCTGATCGCGAAATGGAAGAAGCAAGGATACGAA
AAGCTTTGCTGCCTCCGCTGTGTCCAGACAAAGGAAACCAGCTTCAACAGCACATGCATCTGTCGCGTTCCCCGG
GCCCAACTCAAGGAGGACCGAGATCTTCAATGTGTCAACTGCGGCTACGTTCTGTGA
Gene >Ophio5|5791
ATGCCCGCAATACGCCACGCATCCAAGAGGAAGCCTCCCCCCGAGGGCTTCAGCGACATTGAGGATGACCTTTTG
ATCTTCGCGAACAAGATGAAAGATGCGCACAACAAGCCGCCGCCGCCAGGACCCAAACATCAAGCCCAGTGGGAA
GTCTTCCAGATCTCGCACCAAAGGAGCCGCTATATATACGATCTTTACTACGAGAAAGAGGCTATTAGCAAGGAT
TTATACGACTGGCTTTTGAAGAACGGTTACGCAGACGCCATGCTGATCGCGAAATGGAAGAAGCAAGGATACGAA
AAGGCATCTTCCTAAATGCAACCCCCAAAAAATGACCCGGCTAACCCCTCCCAGCTTTGCTGCCTCCGCTGTGTC
CAGACAAAGGAAACCAGCTTCAACAGCACATGCATCTGTCGCGTTCCCCGGGCCCAACTCAAGGAGGACCGAGAT
CTTCAATGTGTCAACTGCGGCTGTAGAGGCTGTGCCTCGAGCGACTAGTCCATGGCGCTGGACAGTCTCAAACCA
GCGGTGGGGCATTCTAACGGAGCAACACGAACCATAGACGTTCTGGTGCGTTTAGCTCCGGACCGTCAAGACAGA
CGCCTCAGCTTCGCTCGGCTCTTCATCACGTCGCTGATCACGCGTTGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail