Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5783
Gene name
Locationscaffold_484:5956..9775
Strand-
Gene length (bp)3819
Transcript length (bp)3819
Coding sequence length (bp)3816
Protein length (aa) 1272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16414 NPC1_N Niemann-Pick C1 N terminus 4.4E-82 31 264
PF02460 Patched Patched family 4.5E-44 522 868
PF02460 Patched Patched family 8.4E-25 1003 1233
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 6.6E-50 624 776
PF03176 MMPL MMPL family 2.3E-05 622 778

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 33 1259 0.0E+00
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 33 1237 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 33 1237 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 22 1235 0.0E+00
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 33 1246 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 33 1259 0.0E+00
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 33 1237 0.0E+00
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 33 1237 0.0E+00
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 22 1235 0.0E+00
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 33 1246 0.0E+00
sp|Q6T3U4|NPCL1_MOUSE Niemann-Pick C1-like protein 1 OS=Mus musculus GN=Npc1l1 PE=2 SV=1 8 1235 2.0E-170
sp|Q9UHC9|NPCL1_HUMAN Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2 21 1235 1.0E-166
sp|Q19127|NPC1_CAEEL Niemann-Pick C1 protein homolog 1 OS=Caenorhabditis elegans GN=ncr-1 PE=1 SV=2 28 1244 3.0E-100
sp|P34389|NPC2_CAEEL Niemann-Pick C1 protein homolog 2 OS=Caenorhabditis elegans GN=ncr-2 PE=3 SV=2 81 1254 2.0E-99
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 299 1233 3.0E-42
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 532 773 1.0E-19
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 532 773 2.0E-19
sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=3 515 899 3.0E-19
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 574 773 5.0E-19
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 550 772 5.0E-17
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 574 772 3.0E-16
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 1024 1242 2.0E-15
sp|Q09614|PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans GN=ptc-1 PE=1 SV=2 577 896 4.0E-15
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 1024 1242 7.0E-15
sp|P18502|PTC_DROME Protein patched OS=Drosophila melanogaster GN=ptc PE=2 SV=2 530 866 8.0E-15
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 1024 1242 8.0E-15
sp|Q09614|PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans GN=ptc-1 PE=1 SV=2 1024 1242 3.0E-14
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 588 772 3.0E-14
sp|B9EKX1|PTHD4_MOUSE Patched domain-containing protein 4 OS=Mus musculus GN=Ptchd4 PE=2 SV=2 520 1233 3.0E-14
sp|Q9Y6C5|PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens GN=PTCH2 PE=2 SV=2 1024 1209 2.0E-12
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 1007 1209 2.0E-12
sp|Q98864|PTC1_DANRE Protein patched homolog 1 OS=Danio rerio GN=ptch1 PE=2 SV=1 1007 1219 3.0E-12
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 550 766 9.0E-12
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 550 766 3.0E-11
sp|Q96NR3|PTHD1_HUMAN Patched domain-containing protein 1 OS=Homo sapiens GN=PTCHD1 PE=2 SV=2 342 1148 3.0E-11
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 550 766 3.0E-11
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 550 766 3.0E-11
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 550 766 4.0E-11
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 550 766 5.0E-11
sp|Q14B62|PTHD1_MOUSE Patched domain-containing protein 1 OS=Mus musculus GN=Ptchd1 PE=2 SV=2 342 1148 5.0E-11
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 593 766 2.0E-10
sp|Q03602|PTR9_CAEEL Patched-related protein 9 OS=Caenorhabditis elegans GN=ptr-9 PE=3 SV=2 615 760 2.0E-09
sp|Q03602|PTR9_CAEEL Patched-related protein 9 OS=Caenorhabditis elegans GN=ptr-9 PE=3 SV=2 1053 1242 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 268 290 22
2 593 610 17
3 630 652 22
4 659 681 22
5 710 732 22
6 737 759 22
7 825 842 17
8 1069 1091 22
9 1096 1118 22
10 1125 1147 22
11 1177 1199 22
12 1212 1234 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5783
MRHRLAPLLALLLVVAPFLLAEPLTPKHEPGRCAIRGHCGKQSLFGKQLPCVDNGHAREPDSELRKELVDLCGAK
WSHSPVCCTLEQVKALKSELGTPNTLIGSCPACKDNFFNLFCQFACSPDQSLFVNVTASVEKSGKRLVTEMDQLI
SEEYGSGFYDSCKEVKFGGANSRAMDLIGGGAKDYHQFLKFLGDKKPFVGSPFQINFPDSYSNPDMGPLKDMHPK
KCNDSDPDYRCVCVDCPEVCPELPAVRKHGSCKVGVLPCLSFASIFTYCVLLSAFAAFIFGHVAWKKYARHQVER
TRLLHGSSHSDDEDEGGPVLTDAARDRPTRRYWLNDKCDKAFGKLGHVAARFPGLTIGTSLVVVAILSAGWFRFD
LEKEPARLWVSPSSPAAQEKQYFDSNFGPFYRAEKIFLVNDTQPSGPGPVLSYETLKWWSEVEQSIERIVSPAFG
DSLQDICYKPINDACVVQSITSYWWARGGISPTGWKDQLRSCARSPVDCRPKFGQPIEPNMVLGGYGDDVVDAQA
ITVTWVVNNAQEGTAALARAIDWENALRDRLLKVQAEAEARGLRLSFNTEISLEQELNKSTNTDAKIVVVSYVVM
FIYACMALGTPLKHMFRNPALLLVESKVTLGLVGIIIVLMSIAASIGFFSWVGLKATLIIVEVIPFIVLAVGVDN
IFLIVHELERVNASCPDQMVEERAARALGRMGPSILFSALTETVAFALGAAVGMPAVRNFAAYAAGAVLVNAILQ
MTMFVSFLALNQMRVEDHRCELWPWWQVTKARVHMDGSNGFVSGGRGTHDDEEGPLQVFIKNTYAPHLLRGKVKL
AVVAVFLGVFAAALALLPRMQLGLDQRVAIPDGSYLIPYFDDLYDYLETGPPVYFVTRGVDASRRREQQELCSRF
TTCQQLSLTNRLELERQRPDVSYISSPAASWIDDFLLWLNPVYDHCCVEKGSPCFAHRDPAWNTSLSGMPEGDEF
FKYLQKFLTSPASDDCPLGGQAAYGEAVVVDGENTAVRASHFRTAHAPLRSQADFINAYSAARRIAADISDETGA
DVFPYSVFYIFFDQYLSIVSLTAGLLCAAVGIIFVIAFLLLGSALTSAVVAATVVMSVVDIMGAMAVFDVSLNAV
SLVNLIICVGISVEFCAHIARAFTFPSRTVMEGNNNAFRGRDARAWTALVNVGGSVFSGITVTKLLGVCVLAFTR
SKIFEIYYFRVWLALVVFAALHALVFLPVALSFVGGSGYVDPESEGTAAQDLTDRRWRAIRVHDNSDSEDGF
Coding >Ophio5|5783
ATGCGTCATCGGCTCGCACCACTTCTCGCACTTCTGCTCGTGGTCGCGCCCTTCCTCCTCGCCGAGCCCTTGACA
CCCAAACATGAGCCGGGACGGTGCGCGATTCGGGGTCATTGTGGCAAGCAGAGCTTGTTCGGCAAACAGCTGCCG
TGTGTCGACAACGGCCACGCGCGCGAGCCCGACTCGGAGCTTCGCAAGGAGCTCGTCGACCTCTGCGGCGCCAAA
TGGAGTCACTCTCCTGTCTGCTGCACGCTGGAGCAGGTCAAGGCGCTCAAATCTGAGCTCGGCACGCCCAACACG
CTCATCGGCTCCTGCCCGGCATGCAAAGACAACTTCTTCAACCTCTTTTGCCAATTCGCCTGCTCTCCCGACCAG
TCTCTCTTCGTCAACGTCACCGCCTCGGTGGAAAAGAGTGGCAAGCGCCTCGTCACTGAGATGGATCAGCTGATA
TCCGAGGAATATGGCTCCGGCTTCTACGACAGCTGCAAAGAGGTCAAGTTTGGCGGCGCCAACTCCAGGGCCATG
GACTTGATTGGCGGCGGTGCCAAGGACTATCACCAGTTCCTCAAGTTCCTCGGCGACAAGAAGCCCTTCGTCGGC
TCCCCCTTCCAGATCAATTTTCCCGATTCGTACAGCAATCCCGACATGGGTCCTCTCAAGGACATGCATCCCAAG
AAGTGCAACGACTCAGACCCCGACTACCGCTGCGTCTGTGTCGACTGTCCCGAGGTCTGCCCCGAGCTCCCCGCC
GTCCGCAAGCACGGCTCCTGCAAGGTGGGCGTCCTGCCTTGTTTGTCCTTCGCCTCCATCTTCACCTACTGCGTC
CTCCTCTCCGCCTTTGCCGCCTTCATCTTCGGTCACGTCGCGTGGAAGAAGTACGCACGACACCAAGTCGAGAGG
ACGAGGCTTCTCCACGGATCGTCCCACAGCGACGACGAGGATGAGGGCGGCCCGGTCTTGACCGACGCCGCGCGT
GATCGTCCGACCAGGCGCTACTGGCTCAACGACAAGTGCGACAAGGCCTTTGGCAAGCTCGGCCACGTCGCAGCC
CGCTTCCCTGGCCTAACCATCGGCACGAGCCTCGTTGTCGTCGCTATCCTGAGCGCCGGCTGGTTCAGATTCGAC
TTGGAGAAAGAGCCCGCTCGGCTCTGGGTCAGTCCGTCCTCGCCCGCCGCTCAGGAGAAACAATACTTCGACTCC
AATTTCGGCCCATTCTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACGCAACCCTCAGGGCCCGGCCCGGTC
CTGAGTTACGAGACGCTCAAGTGGTGGTCTGAGGTGGAGCAGAGCATCGAGCGCATCGTCAGCCCGGCCTTCGGA
GACAGTCTCCAAGACATATGCTACAAGCCAATCAACGACGCGTGTGTTGTCCAGTCCATCACGTCGTACTGGTGG
GCCCGCGGCGGCATCAGCCCAACCGGTTGGAAGGATCAGCTCCGCAGCTGTGCTAGGTCTCCGGTCGACTGCCGA
CCAAAGTTTGGACAGCCCATCGAGCCGAACATGGTTCTGGGCGGATATGGCGACGACGTGGTCGATGCCCAGGCC
ATCACCGTCACTTGGGTCGTCAACAACGCCCAAGAGGGTACCGCGGCTCTGGCCCGAGCCATCGACTGGGAGAAT
GCGCTTCGTGATCGGCTGCTCAAGGTCCAGGCCGAGGCGGAAGCCCGAGGTCTCCGGCTGTCCTTCAACACGGAG
ATCAGTCTGGAGCAGGAGCTCAACAAGTCGACCAACACCGACGCCAAGATCGTCGTCGTCAGCTACGTCGTCATG
TTCATCTACGCGTGCATGGCGCTGGGCACGCCCTTGAAGCACATGTTCCGGAACCCGGCCCTGCTACTGGTCGAG
TCCAAGGTGACGCTGGGCCTCGTCGGTATCATCATTGTGCTCATGTCCATTGCTGCCTCCATCGGCTTCTTCTCG
TGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCATTCATCGTGCTGGCCGTCGGCGTTGACAAC
ATCTTCCTCATCGTTCACGAGCTGGAGCGCGTCAATGCCAGCTGCCCTGACCAAATGGTCGAGGAGCGAGCGGCG
AGGGCCCTCGGCCGCATGGGTCCGTCGATTCTCTTCTCGGCTCTGACGGAGACGGTGGCGTTTGCACTGGGAGCG
GCCGTCGGGATGCCTGCGGTCCGCAACTTTGCCGCCTATGCCGCCGGCGCCGTACTCGTCAACGCCATACTCCAG
ATGACCATGTTCGTCTCCTTTTTGGCCCTCAACCAGATGCGAGTCGAGGATCACCGCTGCGAGCTGTGGCCGTGG
TGGCAGGTTACCAAGGCCCGCGTTCACATGGACGGCAGCAACGGCTTCGTCTCGGGCGGGCGAGGGACACACGAC
GATGAGGAGGGTCCCCTGCAGGTCTTTATCAAGAACACCTACGCTCCTCACTTGCTCCGTGGAAAGGTGAAGCTG
GCCGTCGTCGCCGTCTTCCTGGGCGTCTTTGCCGCCGCGTTGGCGCTGCTGCCTCGGATGCAGCTCGGGCTCGAC
CAGCGCGTGGCCATACCGGACGGCTCCTACCTCATCCCTTACTTTGACGACTTGTACGACTACCTGGAGACGGGC
CCGCCTGTTTACTTCGTTACGCGCGGCGTAGACGCGTCGCGAAGGCGAGAGCAGCAAGAGCTCTGCTCCAGGTTT
ACTACGTGCCAGCAACTGTCCCTGACAAACAGACTGGAGCTCGAGCGGCAACGCCCGGACGTCTCTTACATCTCA
TCTCCGGCGGCCAGCTGGATCGACGACTTCTTACTCTGGCTCAACCCTGTGTACGATCACTGCTGCGTCGAGAAG
GGATCCCCATGCTTCGCCCATCGTGACCCGGCTTGGAACACATCACTCTCCGGCATGCCGGAAGGTGACGAGTTT
TTCAAGTATCTTCAGAAGTTCCTCACGTCACCGGCCAGCGACGACTGCCCGCTGGGTGGCCAGGCTGCGTACGGT
GAGGCTGTGGTTGTCGATGGCGAGAACACGGCGGTCAGGGCCAGCCACTTCCGTACCGCGCACGCGCCGCTTAGG
AGCCAGGCCGACTTCATCAATGCCTACTCGGCCGCTCGGCGCATCGCGGCCGACATCAGCGACGAGACGGGCGCG
GACGTGTTCCCGTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGAGCATCGTCTCGCTCACGGCCGGGCTC
CTCTGCGCGGCCGTGGGCATCATCTTCGTCATCGCGTTCCTGCTCCTGGGCTCGGCCCTCACGTCGGCCGTCGTG
GCGGCCACGGTGGTCATGAGCGTCGTCGACATCATGGGCGCCATGGCGGTCTTCGACGTCTCCCTCAACGCCGTG
TCGCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCCCACATCGCCCGCGCCTTCACCTTT
CCCTCCCGCACCGTCATGGAAGGCAACAACAACGCGTTTCGCGGCCGAGACGCCCGGGCGTGGACGGCGCTGGTC
AACGTCGGCGGGTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTGGCCTTCACCCGG
TCCAAGATCTTTGAGATTTACTACTTCCGCGTCTGGCTAGCCCTCGTCGTCTTCGCCGCTCTGCACGCGCTCGTC
TTCTTGCCCGTCGCCCTGAGCTTCGTCGGAGGCAGTGGCTACGTCGACCCGGAGAGCGAGGGCACGGCGGCCCAG
GACCTCACCGACAGGAGGTGGCGCGCCATCAGGGTCCATGACAATAGCGACTCCGAGGACGGCTTC
Transcript >Ophio5|5783
ATGCGTCATCGGCTCGCACCACTTCTCGCACTTCTGCTCGTGGTCGCGCCCTTCCTCCTCGCCGAGCCCTTGACA
CCCAAACATGAGCCGGGACGGTGCGCGATTCGGGGTCATTGTGGCAAGCAGAGCTTGTTCGGCAAACAGCTGCCG
TGTGTCGACAACGGCCACGCGCGCGAGCCCGACTCGGAGCTTCGCAAGGAGCTCGTCGACCTCTGCGGCGCCAAA
TGGAGTCACTCTCCTGTCTGCTGCACGCTGGAGCAGGTCAAGGCGCTCAAATCTGAGCTCGGCACGCCCAACACG
CTCATCGGCTCCTGCCCGGCATGCAAAGACAACTTCTTCAACCTCTTTTGCCAATTCGCCTGCTCTCCCGACCAG
TCTCTCTTCGTCAACGTCACCGCCTCGGTGGAAAAGAGTGGCAAGCGCCTCGTCACTGAGATGGATCAGCTGATA
TCCGAGGAATATGGCTCCGGCTTCTACGACAGCTGCAAAGAGGTCAAGTTTGGCGGCGCCAACTCCAGGGCCATG
GACTTGATTGGCGGCGGTGCCAAGGACTATCACCAGTTCCTCAAGTTCCTCGGCGACAAGAAGCCCTTCGTCGGC
TCCCCCTTCCAGATCAATTTTCCCGATTCGTACAGCAATCCCGACATGGGTCCTCTCAAGGACATGCATCCCAAG
AAGTGCAACGACTCAGACCCCGACTACCGCTGCGTCTGTGTCGACTGTCCCGAGGTCTGCCCCGAGCTCCCCGCC
GTCCGCAAGCACGGCTCCTGCAAGGTGGGCGTCCTGCCTTGTTTGTCCTTCGCCTCCATCTTCACCTACTGCGTC
CTCCTCTCCGCCTTTGCCGCCTTCATCTTCGGTCACGTCGCGTGGAAGAAGTACGCACGACACCAAGTCGAGAGG
ACGAGGCTTCTCCACGGATCGTCCCACAGCGACGACGAGGATGAGGGCGGCCCGGTCTTGACCGACGCCGCGCGT
GATCGTCCGACCAGGCGCTACTGGCTCAACGACAAGTGCGACAAGGCCTTTGGCAAGCTCGGCCACGTCGCAGCC
CGCTTCCCTGGCCTAACCATCGGCACGAGCCTCGTTGTCGTCGCTATCCTGAGCGCCGGCTGGTTCAGATTCGAC
TTGGAGAAAGAGCCCGCTCGGCTCTGGGTCAGTCCGTCCTCGCCCGCCGCTCAGGAGAAACAATACTTCGACTCC
AATTTCGGCCCATTCTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACGCAACCCTCAGGGCCCGGCCCGGTC
CTGAGTTACGAGACGCTCAAGTGGTGGTCTGAGGTGGAGCAGAGCATCGAGCGCATCGTCAGCCCGGCCTTCGGA
GACAGTCTCCAAGACATATGCTACAAGCCAATCAACGACGCGTGTGTTGTCCAGTCCATCACGTCGTACTGGTGG
GCCCGCGGCGGCATCAGCCCAACCGGTTGGAAGGATCAGCTCCGCAGCTGTGCTAGGTCTCCGGTCGACTGCCGA
CCAAAGTTTGGACAGCCCATCGAGCCGAACATGGTTCTGGGCGGATATGGCGACGACGTGGTCGATGCCCAGGCC
ATCACCGTCACTTGGGTCGTCAACAACGCCCAAGAGGGTACCGCGGCTCTGGCCCGAGCCATCGACTGGGAGAAT
GCGCTTCGTGATCGGCTGCTCAAGGTCCAGGCCGAGGCGGAAGCCCGAGGTCTCCGGCTGTCCTTCAACACGGAG
ATCAGTCTGGAGCAGGAGCTCAACAAGTCGACCAACACCGACGCCAAGATCGTCGTCGTCAGCTACGTCGTCATG
TTCATCTACGCGTGCATGGCGCTGGGCACGCCCTTGAAGCACATGTTCCGGAACCCGGCCCTGCTACTGGTCGAG
TCCAAGGTGACGCTGGGCCTCGTCGGTATCATCATTGTGCTCATGTCCATTGCTGCCTCCATCGGCTTCTTCTCG
TGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCATTCATCGTGCTGGCCGTCGGCGTTGACAAC
ATCTTCCTCATCGTTCACGAGCTGGAGCGCGTCAATGCCAGCTGCCCTGACCAAATGGTCGAGGAGCGAGCGGCG
AGGGCCCTCGGCCGCATGGGTCCGTCGATTCTCTTCTCGGCTCTGACGGAGACGGTGGCGTTTGCACTGGGAGCG
GCCGTCGGGATGCCTGCGGTCCGCAACTTTGCCGCCTATGCCGCCGGCGCCGTACTCGTCAACGCCATACTCCAG
ATGACCATGTTCGTCTCCTTTTTGGCCCTCAACCAGATGCGAGTCGAGGATCACCGCTGCGAGCTGTGGCCGTGG
TGGCAGGTTACCAAGGCCCGCGTTCACATGGACGGCAGCAACGGCTTCGTCTCGGGCGGGCGAGGGACACACGAC
GATGAGGAGGGTCCCCTGCAGGTCTTTATCAAGAACACCTACGCTCCTCACTTGCTCCGTGGAAAGGTGAAGCTG
GCCGTCGTCGCCGTCTTCCTGGGCGTCTTTGCCGCCGCGTTGGCGCTGCTGCCTCGGATGCAGCTCGGGCTCGAC
CAGCGCGTGGCCATACCGGACGGCTCCTACCTCATCCCTTACTTTGACGACTTGTACGACTACCTGGAGACGGGC
CCGCCTGTTTACTTCGTTACGCGCGGCGTAGACGCGTCGCGAAGGCGAGAGCAGCAAGAGCTCTGCTCCAGGTTT
ACTACGTGCCAGCAACTGTCCCTGACAAACAGACTGGAGCTCGAGCGGCAACGCCCGGACGTCTCTTACATCTCA
TCTCCGGCGGCCAGCTGGATCGACGACTTCTTACTCTGGCTCAACCCTGTGTACGATCACTGCTGCGTCGAGAAG
GGATCCCCATGCTTCGCCCATCGTGACCCGGCTTGGAACACATCACTCTCCGGCATGCCGGAAGGTGACGAGTTT
TTCAAGTATCTTCAGAAGTTCCTCACGTCACCGGCCAGCGACGACTGCCCGCTGGGTGGCCAGGCTGCGTACGGT
GAGGCTGTGGTTGTCGATGGCGAGAACACGGCGGTCAGGGCCAGCCACTTCCGTACCGCGCACGCGCCGCTTAGG
AGCCAGGCCGACTTCATCAATGCCTACTCGGCCGCTCGGCGCATCGCGGCCGACATCAGCGACGAGACGGGCGCG
GACGTGTTCCCGTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGAGCATCGTCTCGCTCACGGCCGGGCTC
CTCTGCGCGGCCGTGGGCATCATCTTCGTCATCGCGTTCCTGCTCCTGGGCTCGGCCCTCACGTCGGCCGTCGTG
GCGGCCACGGTGGTCATGAGCGTCGTCGACATCATGGGCGCCATGGCGGTCTTCGACGTCTCCCTCAACGCCGTG
TCGCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCCCACATCGCCCGCGCCTTCACCTTT
CCCTCCCGCACCGTCATGGAAGGCAACAACAACGCGTTTCGCGGCCGAGACGCCCGGGCGTGGACGGCGCTGGTC
AACGTCGGCGGGTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTGGCCTTCACCCGG
TCCAAGATCTTTGAGATTTACTACTTCCGCGTCTGGCTAGCCCTCGTCGTCTTCGCCGCTCTGCACGCGCTCGTC
TTCTTGCCCGTCGCCCTGAGCTTCGTCGGAGGCAGTGGCTACGTCGACCCGGAGAGCGAGGGCACGGCGGCCCAG
GACCTCACCGACAGGAGGTGGCGCGCCATCAGGGTCCATGACAATAGCGACTCCGAGGACGGCTTCTAG
Gene >Ophio5|5783
ATGCGTCATCGGCTCGCACCACTTCTCGCACTTCTGCTCGTGGTCGCGCCCTTCCTCCTCGCCGAGCCCTTGACA
CCCAAACATGAGCCGGGACGGTGCGCGATTCGGGGTCATTGTGGCAAGCAGAGCTTGTTCGGCAAACAGCTGCCG
TGTGTCGACAACGGCCACGCGCGCGAGCCCGACTCGGAGCTTCGCAAGGAGCTCGTCGACCTCTGCGGCGCCAAA
TGGAGTCACTCTCCTGTCTGCTGCACGCTGGAGCAGGTCAAGGCGCTCAAATCTGAGCTCGGCACGCCCAACACG
CTCATCGGCTCCTGCCCGGCATGCAAAGACAACTTCTTCAACCTCTTTTGCCAATTCGCCTGCTCTCCCGACCAG
TCTCTCTTCGTCAACGTCACCGCCTCGGTGGAAAAGAGTGGCAAGCGCCTCGTCACTGAGATGGATCAGCTGATA
TCCGAGGAATATGGCTCCGGCTTCTACGACAGCTGCAAAGAGGTCAAGTTTGGCGGCGCCAACTCCAGGGCCATG
GACTTGATTGGCGGCGGTGCCAAGGACTATCACCAGTTCCTCAAGTTCCTCGGCGACAAGAAGCCCTTCGTCGGC
TCCCCCTTCCAGATCAATTTTCCCGATTCGTACAGCAATCCCGACATGGGTCCTCTCAAGGACATGCATCCCAAG
AAGTGCAACGACTCAGACCCCGACTACCGCTGCGTCTGTGTCGACTGTCCCGAGGTCTGCCCCGAGCTCCCCGCC
GTCCGCAAGCACGGCTCCTGCAAGGTGGGCGTCCTGCCTTGTTTGTCCTTCGCCTCCATCTTCACCTACTGCGTC
CTCCTCTCCGCCTTTGCCGCCTTCATCTTCGGTCACGTCGCGTGGAAGAAGTACGCACGACACCAAGTCGAGAGG
ACGAGGCTTCTCCACGGATCGTCCCACAGCGACGACGAGGATGAGGGCGGCCCGGTCTTGACCGACGCCGCGCGT
GATCGTCCGACCAGGCGCTACTGGCTCAACGACAAGTGCGACAAGGCCTTTGGCAAGCTCGGCCACGTCGCAGCC
CGCTTCCCTGGCCTAACCATCGGCACGAGCCTCGTTGTCGTCGCTATCCTGAGCGCCGGCTGGTTCAGATTCGAC
TTGGAGAAAGAGCCCGCTCGGCTCTGGGTCAGTCCGTCCTCGCCCGCCGCTCAGGAGAAACAATACTTCGACTCC
AATTTCGGCCCATTCTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACGCAACCCTCAGGGCCCGGCCCGGTC
CTGAGTTACGAGACGCTCAAGTGGTGGTCTGAGGTGGAGCAGAGCATCGAGCGCATCGTCAGCCCGGCCTTCGGA
GACAGTCTCCAAGACATATGCTACAAGCCAATCAACGACGCGTGTGTTGTCCAGTCCATCACGTCGTACTGGTGG
GCCCGCGGCGGCATCAGCCCAACCGGTTGGAAGGATCAGCTCCGCAGCTGTGCTAGGTCTCCGGTCGACTGCCGA
CCAAAGTTTGGACAGCCCATCGAGCCGAACATGGTTCTGGGCGGATATGGCGACGACGTGGTCGATGCCCAGGCC
ATCACCGTCACTTGGGTCGTCAACAACGCCCAAGAGGGTACCGCGGCTCTGGCCCGAGCCATCGACTGGGAGAAT
GCGCTTCGTGATCGGCTGCTCAAGGTCCAGGCCGAGGCGGAAGCCCGAGGTCTCCGGCTGTCCTTCAACACGGAG
ATCAGTCTGGAGCAGGAGCTCAACAAGTCGACCAACACCGACGCCAAGATCGTCGTCGTCAGCTACGTCGTCATG
TTCATCTACGCGTGCATGGCGCTGGGCACGCCCTTGAAGCACATGTTCCGGAACCCGGCCCTGCTACTGGTCGAG
TCCAAGGTGACGCTGGGCCTCGTCGGTATCATCATTGTGCTCATGTCCATTGCTGCCTCCATCGGCTTCTTCTCG
TGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCATTCATCGTGCTGGCCGTCGGCGTTGACAAC
ATCTTCCTCATCGTTCACGAGCTGGAGCGCGTCAATGCCAGCTGCCCTGACCAAATGGTCGAGGAGCGAGCGGCG
AGGGCCCTCGGCCGCATGGGTCCGTCGATTCTCTTCTCGGCTCTGACGGAGACGGTGGCGTTTGCACTGGGAGCG
GCCGTCGGGATGCCTGCGGTCCGCAACTTTGCCGCCTATGCCGCCGGCGCCGTACTCGTCAACGCCATACTCCAG
ATGACCATGTTCGTCTCCTTTTTGGCCCTCAACCAGATGCGAGTCGAGGATCACCGCTGCGAGCTGTGGCCGTGG
TGGCAGGTTACCAAGGCCCGCGTTCACATGGACGGCAGCAACGGCTTCGTCTCGGGCGGGCGAGGGACACACGAC
GATGAGGAGGGTCCCCTGCAGGTCTTTATCAAGAACACCTACGCTCCTCACTTGCTCCGTGGAAAGGTGAAGCTG
GCCGTCGTCGCCGTCTTCCTGGGCGTCTTTGCCGCCGCGTTGGCGCTGCTGCCTCGGATGCAGCTCGGGCTCGAC
CAGCGCGTGGCCATACCGGACGGCTCCTACCTCATCCCTTACTTTGACGACTTGTACGACTACCTGGAGACGGGC
CCGCCTGTTTACTTCGTTACGCGCGGCGTAGACGCGTCGCGAAGGCGAGAGCAGCAAGAGCTCTGCTCCAGGTTT
ACTACGTGCCAGCAACTGTCCCTGACAAACAGACTGGAGCTCGAGCGGCAACGCCCGGACGTCTCTTACATCTCA
TCTCCGGCGGCCAGCTGGATCGACGACTTCTTACTCTGGCTCAACCCTGTGTACGATCACTGCTGCGTCGAGAAG
GGATCCCCATGCTTCGCCCATCGTGACCCGGCTTGGAACACATCACTCTCCGGCATGCCGGAAGGTGACGAGTTT
TTCAAGTATCTTCAGAAGTTCCTCACGTCACCGGCCAGCGACGACTGCCCGCTGGGTGGCCAGGCTGCGTACGGT
GAGGCTGTGGTTGTCGATGGCGAGAACACGGCGGTCAGGGCCAGCCACTTCCGTACCGCGCACGCGCCGCTTAGG
AGCCAGGCCGACTTCATCAATGCCTACTCGGCCGCTCGGCGCATCGCGGCCGACATCAGCGACGAGACGGGCGCG
GACGTGTTCCCGTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGAGCATCGTCTCGCTCACGGCCGGGCTC
CTCTGCGCGGCCGTGGGCATCATCTTCGTCATCGCGTTCCTGCTCCTGGGCTCGGCCCTCACGTCGGCCGTCGTG
GCGGCCACGGTGGTCATGAGCGTCGTCGACATCATGGGCGCCATGGCGGTCTTCGACGTCTCCCTCAACGCCGTG
TCGCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCCCACATCGCCCGCGCCTTCACCTTT
CCCTCCCGCACCGTCATGGAAGGCAACAACAACGCGTTTCGCGGCCGAGACGCCCGGGCGTGGACGGCGCTGGTC
AACGTCGGCGGGTCCGTCTTCTCCGGCATCACCGTCACCAAGCTGCTCGGCGTCTGCGTCCTGGCCTTCACCCGG
TCCAAGATCTTTGAGATTTACTACTTCCGCGTCTGGCTAGCCCTCGTCGTCTTCGCCGCTCTGCACGCGCTCGTC
TTCTTGCCCGTCGCCCTGAGCTTCGTCGGAGGCAGTGGCTACGTCGACCCGGAGAGCGAGGGCACGGCGGCCCAG
GACCTCACCGACAGGAGGTGGCGCGCCATCAGGGTCCATGACAATAGCGACTCCGAGGACGGCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail