Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|578
Gene name
Locationscaffold_115:26774..28551
Strand+
Gene length (bp)1777
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09994 DUF2235 Uncharacterized alpha/beta hydrolase domain (DUF2235) 4.2E-76 7 307

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39992|YEC3_YEAST Uncharacterized protein YEL023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL023C PE=4 SV=1 7 258 1.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6464 0.4091 0.2559 0.2789 0.1696 0.0922 0.0561 0.1562 0.0655 0.1649

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6561
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04975
Ophiocordyceps camponoti-rufipedis Ophun1|5575
Ophiocordyceps kimflemingae Ophio5|578 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2408

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|578
MTAGVKKRLIVCCDGTWMNSAYGYVKPGLLGGRGGLQVPSNVTRISRCFKRRCSDGTLQIINYESGVGSGSNVLD
SITGGAFGVGLAERVREAYSFLCSNYRDGDDMLLVGFSRGAFTARSVAGLLANLGLLTREGVEHFYPIFKDMQNW
HNDDYRDPFPSVPFSEKPRGCGAAAVYRERLVEQGYTRVHQRDGALITVKAICVWETVGSLGIPRVAWLDKMGVR
PGNEEYKWHDTALSDRIEYAFQALALDETRAPFSPALWERPRQAKLATVLKQVWFPGNHSNCGGGWGDQGIANCT
LAWMMDQMASVGVEFDIESLDRVIQLSNDYYVNGARKHGHRRRRRKLRQWAVDAIYDANRPVRPWALGAIQRDPS
LLFKLSGSVTRTPGVYRQVDPKTRVDMSQFLQDTNETVHSSVRTRLACGGLGLNDESIWACSALSSWRLKQVRVM
PSTPDGESKGGDDDKMETRWIWKYVGDELDAPADPSQRTMREEPLGPYERYLVDKSGGSPNVLGFADRRSGWGRK
RISGFPGVKMLE
Coding >Ophio5|578
ATGACGGCGGGCGTGAAAAAGCGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGCTATGTC
AAGCCGGGTCTGCTCGGTGGCCGTGGCGGACTCCAGGTTCCGTCTAATGTGACACGCATATCGCGTTGCTTCAAG
CGCCGTTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGCGGGAGCAACGTCCTGGAC
AGCATCACGGGCGGTGCTTTTGGCGTCGGCCTGGCCGAGCGAGTTCGAGAGGCCTACTCGTTTCTCTGCTCAAAC
TACCGCGACGGCGACGACATGCTCCTCGTCGGCTTCTCCCGCGGCGCCTTCACCGCCCGTTCCGTCGCGGGCCTC
CTCGCCAATCTTGGTCTTCTGACGCGGGAGGGTGTCGAGCACTTCTACCCCATCTTCAAAGACATGCAAAACTGG
CACAATGACGACTATCGTGACCCGTTTCCCTCGGTGCCCTTTTCGGAGAAGCCTCGAGGGTGCGGCGCGGCGGCC
GTGTATCGCGAACGCCTCGTCGAGCAGGGCTACACGCGCGTCCATCAGCGAGACGGCGCCCTCATCACCGTCAAG
GCCATCTGCGTATGGGAAACAGTTGGAAGTCTGGGCATCCCCCGAGTCGCCTGGCTCGACAAGATGGGCGTTCGT
CCGGGTAACGAAGAGTACAAGTGGCACGACACGGCCTTGTCGGACAGGATCGAGTACGCCTTCCAGGCCCTTGCT
CTTGATGAGACGCGCGCCCCTTTCAGCCCTGCTCTGTGGGAGCGTCCGCGGCAGGCTAAGCTGGCGACGGTCCTG
AAGCAAGTTTGGTTCCCGGGAAACCATAGCAACTGCGGTGGTGGCTGGGGCGACCAGGGCATCGCCAACTGCACC
TTGGCTTGGATGATGGACCAGATGGCCAGCGTCGGAGTCGAGTTTGACATTGAGTCTCTCGACCGCGTCATCCAA
CTGTCGAATGACTACTATGTGAACGGCGCTCGCAAGCATGGCCACAGGCGGCGCCGGCGGAAGCTACGGCAATGG
GCCGTCGACGCCATATACGACGCGAACAGGCCGGTGCGTCCATGGGCCCTCGGGGCGATACAGCGAGACCCGAGC
CTACTGTTCAAGCTTTCCGGCTCAGTGACACGTACGCCCGGCGTATACAGGCAGGTAGACCCCAAGACGAGGGTA
GACATGAGCCAGTTCCTACAAGACACCAATGAGACGGTACACAGCTCGGTCCGAACGCGCCTCGCGTGCGGCGGC
CTCGGCCTCAACGACGAGTCCATCTGGGCGTGTTCCGCGCTATCGAGCTGGCGGCTCAAGCAGGTGCGGGTCATG
CCGTCGACGCCCGACGGCGAGAGCAAGGGGGGGGACGACGACAAGATGGAGACGCGCTGGATCTGGAAGTACGTC
GGTGACGAGCTCGACGCCCCGGCCGACCCGAGCCAGAGGACGATGCGGGAGGAGCCGCTGGGGCCGTACGAGCGA
TATCTGGTTGATAAGTCCGGGGGGTCGCCGAATGTGTTGGGCTTTGCCGATAGGAGGTCCGGATGGGGGCGGAAG
AGGATTTCGGGCTTTCCGGGCGTGAAGATGTTGGAG
Transcript >Ophio5|578
ATGACGGCGGGCGTGAAAAAGCGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGCTATGTC
AAGCCGGGTCTGCTCGGTGGCCGTGGCGGACTCCAGGTTCCGTCTAATGTGACACGCATATCGCGTTGCTTCAAG
CGCCGTTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGCGGGAGCAACGTCCTGGAC
AGCATCACGGGCGGTGCTTTTGGCGTCGGCCTGGCCGAGCGAGTTCGAGAGGCCTACTCGTTTCTCTGCTCAAAC
TACCGCGACGGCGACGACATGCTCCTCGTCGGCTTCTCCCGCGGCGCCTTCACCGCCCGTTCCGTCGCGGGCCTC
CTCGCCAATCTTGGTCTTCTGACGCGGGAGGGTGTCGAGCACTTCTACCCCATCTTCAAAGACATGCAAAACTGG
CACAATGACGACTATCGTGACCCGTTTCCCTCGGTGCCCTTTTCGGAGAAGCCTCGAGGGTGCGGCGCGGCGGCC
GTGTATCGCGAACGCCTCGTCGAGCAGGGCTACACGCGCGTCCATCAGCGAGACGGCGCCCTCATCACCGTCAAG
GCCATCTGCGTATGGGAAACAGTTGGAAGTCTGGGCATCCCCCGAGTCGCCTGGCTCGACAAGATGGGCGTTCGT
CCGGGTAACGAAGAGTACAAGTGGCACGACACGGCCTTGTCGGACAGGATCGAGTACGCCTTCCAGGCCCTTGCT
CTTGATGAGACGCGCGCCCCTTTCAGCCCTGCTCTGTGGGAGCGTCCGCGGCAGGCTAAGCTGGCGACGGTCCTG
AAGCAAGTTTGGTTCCCGGGAAACCATAGCAACTGCGGTGGTGGCTGGGGCGACCAGGGCATCGCCAACTGCACC
TTGGCTTGGATGATGGACCAGATGGCCAGCGTCGGAGTCGAGTTTGACATTGAGTCTCTCGACCGCGTCATCCAA
CTGTCGAATGACTACTATGTGAACGGCGCTCGCAAGCATGGCCACAGGCGGCGCCGGCGGAAGCTACGGCAATGG
GCCGTCGACGCCATATACGACGCGAACAGGCCGGTGCGTCCATGGGCCCTCGGGGCGATACAGCGAGACCCGAGC
CTACTGTTCAAGCTTTCCGGCTCAGTGACACGTACGCCCGGCGTATACAGGCAGGTAGACCCCAAGACGAGGGTA
GACATGAGCCAGTTCCTACAAGACACCAATGAGACGGTACACAGCTCGGTCCGAACGCGCCTCGCGTGCGGCGGC
CTCGGCCTCAACGACGAGTCCATCTGGGCGTGTTCCGCGCTATCGAGCTGGCGGCTCAAGCAGGTGCGGGTCATG
CCGTCGACGCCCGACGGCGAGAGCAAGGGGGGGGACGACGACAAGATGGAGACGCGCTGGATCTGGAAGTACGTC
GGTGACGAGCTCGACGCCCCGGCCGACCCGAGCCAGAGGACGATGCGGGAGGAGCCGCTGGGGCCGTACGAGCGA
TATCTGGTTGATAAGTCCGGGGGGTCGCCGAATGTGTTGGGCTTTGCCGATAGGAGGTCCGGATGGGGGCGGAAG
AGGATTTCGGGCTTTCCGGGCGTGAAGATGTTGGAGTGA
Gene >Ophio5|578
ATGACGGCGGGCGTGAAAAAGCGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGCTATGTC
AAGCCGGGTCTGCTCGGTGGCCGTGGCGGACTCCAGGTTCCGTCTAATGTGACACGCATATCGCGTTGCTTCAAG
CGCCGTTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGCGGGAGCAACGTCCTGGAC
AGCATCACGGGCGGTGCTTTTGGCGTCGGCCTGGCCGAGGTCAGTTCGCCAATCTGTCTCGTTCCGGATGGGAAC
TAAACTTCCTACGGGTTTCAGCGAGTTCGAGAGGCCTACTCGTTTCTCTGCTCAAACTACCGCGACGGCGACGAC
ATGCTCCTCGTCGGCTTCTCCCGCGGCGCCTTCACCGCCCGTTCCGTCGCGGGCCTCCTCGCCAATCTTGGTCTT
CTGACGCGGGAGGGTGTCGAGCACTTCTACCCCATCTTCAAAGACATGCAAAACTGGCACAATGACGACTATCGT
GACCCGTTTCCCTCGGTGCCCTTTTCGGAGAAGCCTCGAGGGTGCGGCGCGGCGGCCGTGTATCGCGAACGCCTC
GTCGAGCAGGGCTACACGCGCGTCCATCAGCGAGACGGCGCCCTCATCACCGTCAAGGCCATCTGCGTATGGGAA
ACAGTTGGAAGTCTGGGCATCCCCCGAGTCGCCTGGCTCGACAAGATGGGCGTTCGTCCGGGTAACGAAGAATAA
GTCATCCCCCCCTTCTTTTTCCCTCCCTCGTGCTGACCGTCGAGAACGTACAAGTGGCACGACACGGCCTTGTCG
GACAGGATCGAGTACGCCTTCCAGGCCCTTGCTCTTGATGAGACGCGCGCCCCTTTCAGCCCTGCTCTGTGGGAG
CGTCCGCGGCAGGCTAAGCTGGCGACGGTCCTGAAGCAAGTTTGGTTCCCGGGAAACCATAGCAACTGCGGTGGT
GGCTGGGGCGACCAGGGCATCGCCAACTGCACCTTGGCTTGTGCGTGTGTGTGCCCGAGAGTCGAGCTCGGTGGA
TAAGCTTACGCCTTGGGCAGGGATGATGGACCAGATGGCCAGCGTCGGAGTCGAGTTTGACATTGAGTCTCTCGA
CCGCGTCATCCAACTGTCGAATGACTACTATGTGAACGGCGCTCGCAAGCATGGCCACAGGCGGCGCCGGCGGAA
GCTACGGCAATGGGCCGTCGACGCCATATACGACGCGAACAGGCCGGTGCGTCCATGGGCCCTCGGGGCGATACA
GCGAGACCCGAGCCTACTGTTCAAGCTTTCCGGCTCAGTGACACGTACGCCCGGCGTATACAGGCAGGTAGACCC
CAAGACGAGGGTAGACATGAGCCAGTTCCTACAAGACACCAATGAGACGGTACACAGCTCGGTCCGAACGCGCCT
CGCGTGCGGCGGCCTCGGCCTCAACGACGAGTCCATCTGGGCGTGTTCCGCGCTATCGAGCTGGCGGCTCAAGCA
GGTGCGGGTCATGCCGTCGACGCCCGACGGCGAGAGCAAGGGGGGGGACGACGACAAGATGGAGACGCGCTGGAT
CTGGAAGTACGTCGGTGACGAGCTCGACGCCCCGGCCGACCCGAGCCAGAGGACGATGCGGGAGGAGCCGCTGGG
GCCGTACGAGCGATATCTGGTTGATAAGTCCGGGGGGTCGCCGAATGTGTTGGGCTTTGCCGATAGGAGGTCCGG
ATGGGGGCGGAAGAGGATTTCGGGCTTTCCGGGCGTGAAGATGTTGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail