Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5775
Gene name
Locationscaffold_483:5813..6701
Strand-
Gene length (bp)888
Transcript length (bp)777
Coding sequence length (bp)774
Protein length (aa) 258

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04062 P21-Arc ARP2/3 complex ARPC3 (21 kDa) subunit 6.1E-72 68 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05933|ARPC3_YEAST Actin-related protein 2/3 complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC18 PE=1 SV=1 69 258 1.0E-61
sp|Q9Y7J4|ARPC3_SCHPO Actin-related protein 2/3 complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc3 PE=1 SV=1 69 258 1.0E-55
sp|O96624|ARPC3_DICDI Actin-related protein 2/3 complex subunit 3 OS=Dictyostelium discoideum GN=arcC PE=1 SV=1 69 258 5.0E-49
sp|Q9JM76|ARPC3_MOUSE Actin-related protein 2/3 complex subunit 3 OS=Mus musculus GN=Arpc3 PE=1 SV=3 69 258 3.0E-44
sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens GN=ARPC3 PE=1 SV=3 69 258 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05933|ARPC3_YEAST Actin-related protein 2/3 complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC18 PE=1 SV=1 69 258 1.0E-61
sp|Q9Y7J4|ARPC3_SCHPO Actin-related protein 2/3 complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc3 PE=1 SV=1 69 258 1.0E-55
sp|O96624|ARPC3_DICDI Actin-related protein 2/3 complex subunit 3 OS=Dictyostelium discoideum GN=arcC PE=1 SV=1 69 258 5.0E-49
sp|Q9JM76|ARPC3_MOUSE Actin-related protein 2/3 complex subunit 3 OS=Mus musculus GN=Arpc3 PE=1 SV=3 69 258 3.0E-44
sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens GN=ARPC3 PE=1 SV=3 69 258 6.0E-44
sp|Q3T035|ARPC3_BOVIN Actin-related protein 2/3 complex subunit 3 OS=Bos taurus GN=ARPC3 PE=1 SV=3 69 258 6.0E-44
sp|Q9XWV3|ARPC3_CAEEL Probable actin-related protein 2/3 complex subunit 3 OS=Caenorhabditis elegans GN=arx-5 PE=3 SV=1 69 258 8.0E-39
sp|Q1ECJ7|ARPC3_ARATH Actin-related protein 2/3 complex subunit 3 OS=Arabidopsis thaliana GN=ARPC3 PE=1 SV=1 69 254 2.0E-34
sp|O15604|ARPC3_ENTHI Probable actin-related protein 2/3 complex subunit 3 (Fragment) OS=Entamoeba histolytica PE=2 SV=1 67 205 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0030833 regulation of actin filament polymerization Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0005856 cytoskeleton Yes
GO:0032991 protein-containing complex No
GO:0097435 supramolecular fiber organization No
GO:0030832 regulation of actin filament length No
GO:0065008 regulation of biological quality No
GO:0045010 actin nucleation No
GO:0032535 regulation of cellular component size No
GO:0043226 organelle No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0065007 biological regulation No
GO:0090066 regulation of anatomical structure size No
GO:0043228 non-membrane-bounded organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0050794 regulation of cellular process No
GO:0051128 regulation of cellular component organization No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0032970 regulation of actin filament-based process No
GO:0110053 regulation of actin filament organization No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0007015 actin filament organization No
GO:0043254 regulation of protein-containing complex assembly No
GO:0016043 cellular component organization No
GO:1902903 regulation of supramolecular fiber organization No
GO:0032271 regulation of protein polymerization No
GO:0050789 regulation of biological process No
GO:0033043 regulation of organelle organization No
GO:0044087 regulation of cellular component biogenesis No
GO:0051493 regulation of cytoskeleton organization No
GO:0071840 cellular component organization or biogenesis No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5891 0.4606 0.2175 0.1554 0.2874 0.1282 0.2106 0.1722 0.1833 0.1031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2824
Ophiocordyceps camponoti-floridani Ophcf2|03699
Ophiocordyceps camponoti-rufipedis Ophun1|6258
Ophiocordyceps kimflemingae Ophio5|5775 (this protein)
Ophiocordyceps subramaniannii Hirsu2|703

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5775
MVNFLGRATPSDPPTAPPSGAAVVIVVSFAQPVEPFARPLSPPSHEDAAIFPPIFHSFELTSSPLPSQAYNSVFN
DDPNPPRLIGNFPLLPLRTKTRGPAYTLPIPAPPLPPAESPDPDNESYDILDETLSLFRANTFFRNFEIQGPADR
LLVYGIWFLSDCLQKIKPNASARDAQKDVMNLALDLHFAIPGDPGFPLNQMYEPPRDRQDAEQLKLYMSQVRQEL
AIRLLARIYADDETKPSKWWLSFTKRKFMGKAL
Coding >Ophio5|5775
ATGGTCAACTTTCTCGGCCGTGCCACCCCCTCCGACCCTCCGACCGCGCCGCCATCCGGAGCTGCCGTCGTCATC
GTCGTCAGCTTCGCCCAGCCTGTCGAGCCCTTTGCCCGTCCCCTCTCCCCTCCCTCACACGAAGATGCCGCAATC
TTCCCTCCCATCTTTCACTCGTTCGAGCTCACTTCCTCTCCTCTTCCTTCCCAGGCCTACAACTCCGTCTTCAAC
GACGATCCCAACCCGCCACGTCTCATCGGCAACTTCCCCCTCCTCCCTCTGCGCACAAAGACTCGTGGCCCGGCC
TACACCTTACCGATTCCCGCGCCCCCGCTCCCACCTGCTGAATCGCCAGACCCGGATAACGAGAGTTACGACATC
CTTGACGAGACGCTCTCCCTCTTTCGCGCAAACACCTTCTTCCGCAACTTCGAGATCCAGGGCCCGGCCGATCGT
CTCCTCGTCTATGGCATCTGGTTTCTCAGCGACTGTCTTCAGAAGATTAAGCCTAATGCCTCCGCCCGCGATGCG
CAAAAGGATGTCATGAACCTCGCACTCGACCTTCACTTCGCCATACCCGGCGACCCCGGGTTTCCCCTCAATCAG
ATGTACGAGCCGCCGCGGGACCGACAGGACGCCGAGCAGCTAAAGCTGTACATGTCCCAGGTGCGCCAGGAGCTC
GCCATCCGCTTGCTCGCCAGGATCTATGCCGACGACGAGACCAAGCCGAGCAAGTGGTGGTTGAGCTTCACCAAG
AGGAAGTTTATGGGCAAGGCGCTT
Transcript >Ophio5|5775
ATGGTCAACTTTCTCGGCCGTGCCACCCCCTCCGACCCTCCGACCGCGCCGCCATCCGGAGCTGCCGTCGTCATC
GTCGTCAGCTTCGCCCAGCCTGTCGAGCCCTTTGCCCGTCCCCTCTCCCCTCCCTCACACGAAGATGCCGCAATC
TTCCCTCCCATCTTTCACTCGTTCGAGCTCACTTCCTCTCCTCTTCCTTCCCAGGCCTACAACTCCGTCTTCAAC
GACGATCCCAACCCGCCACGTCTCATCGGCAACTTCCCCCTCCTCCCTCTGCGCACAAAGACTCGTGGCCCGGCC
TACACCTTACCGATTCCCGCGCCCCCGCTCCCACCTGCTGAATCGCCAGACCCGGATAACGAGAGTTACGACATC
CTTGACGAGACGCTCTCCCTCTTTCGCGCAAACACCTTCTTCCGCAACTTCGAGATCCAGGGCCCGGCCGATCGT
CTCCTCGTCTATGGCATCTGGTTTCTCAGCGACTGTCTTCAGAAGATTAAGCCTAATGCCTCCGCCCGCGATGCG
CAAAAGGATGTCATGAACCTCGCACTCGACCTTCACTTCGCCATACCCGGCGACCCCGGGTTTCCCCTCAATCAG
ATGTACGAGCCGCCGCGGGACCGACAGGACGCCGAGCAGCTAAAGCTGTACATGTCCCAGGTGCGCCAGGAGCTC
GCCATCCGCTTGCTCGCCAGGATCTATGCCGACGACGAGACCAAGCCGAGCAAGTGGTGGTTGAGCTTCACCAAG
AGGAAGTTTATGGGCAAGGCGCTTTGA
Gene >Ophio5|5775
ATGGTCAACTTTCTCGGCCGTGCCACCCCCTCCGACCCTCCGACCGCGCCGCCATCCGGAGCTGCCGTCGTCATC
GTCGTCAGCTTCGCCCAGCCTGTCGAGCCCTTTGCCCGTCCCCTCTCCCCTCCCTCACACGAAGATGCCGGTACG
TCATGGAACAACAATAACTAACCCCTCCCCCCCCCCCCCCTAAAAGCAATCTTCCCTCCCATCTTTCACTCGTTC
GAGCTCACTTCCTCTCCTCTTCCTTCCCAGGCCTACAACTCCGTCTTCAACGACGATCCCAACCCGCCACGTCTC
ATCGGCAACTTCCCCCTCCTCCCTCTGCGCACAAAGACTCGTGGCCCGGCCTACACCTTACCGATTCCCGCGCCC
CCGCTCCCACCTGCTGAATCGCCAGACCCGGATAACGAGAGTTACGACATCCTTGACGAGACGCTCTCCCTCTTT
CGCGCAAACACCTTCTTCCGCAACTTCGAGATCCAGGGCCCGGCCGATCGTCTCCTCGTCTATGGCATCTGGTTT
CTCAGCGACTGTCTTCAGAAGATTAAGCCTAATGCCTCCGCCCGCGATGCGCAAAAGGATGTCATGAACCTCGCA
CTCGACCTTCACTTCGCCATACCCGGCGACCCCGGGTTTCCCCTCAATCAGGTCCGCTACCTCTTCTTGCCGACC
CTCCCTGTTTTCCCTTCGGAGCTGACGCTTGGCCAGATGTACGAGCCGCCGCGGGACCGACAGGACGCCGAGCAG
CTAAAGCTGTACATGTCCCAGGTGCGCCAGGAGCTCGCCATCCGCTTGCTCGCCAGGATCTATGCCGACGACGAG
ACCAAGCCGAGCAAGTGGTGGTTGAGCTTCACCAAGAGGAAGTTTATGGGCAAGGCGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail