Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5771
Gene name
Locationscaffold_482:10996..12479
Strand+
Gene length (bp)1483
Transcript length (bp)1290
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 374 396 22
2 401 423 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 23.26 11.15 35.37
CcL In ants, during behavior modification 6.03 1.78 10.29
CcD In ants, recently dead 12.03 4.82 19.24

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.016488 yes
CcL CcD 0.037825 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5771
MAFDGVTRLRQQPTCPGGGEERLQSEFFFVFFSLPFLRTTSSPYEHGGRTLDAAMWWGMGITDTAKLSRSGRRVF
LHKADELLARLERVRERAAGRAEPGAVAVAMVEKEKEKEKEEEEEEEEEGEVNGTMSMDNEMNGTTTKVSNLGKT
SRDDKAEETRQTQMQDDRLDGPELNKPKHTLTQDAEVGETKQTTMMQVSSYQTHLDSRQDHVCQQAADQRSPESS
KLSPAREAGHVLLSPWPETFAGRLETYLDAMDSDQSKDDGPDQLAMTPSHLGRLDEDIGQVAHLRASLLESISQL
DRRRTCHSDRWKRAGGAADVAALMKSRGLGSLLARTADTYQDQPPRDEWEDWSSPRSGRSRLRGAEQYYGGAPII
IIIIFFFFIIFFFFIIILFFFFLFFFFIFFIFLIIIIIIIIIVFFFFFLQSRVS
Coding >Ophio5|5771
ATGGCTTTTGATGGCGTCACGCGGCTTCGTCAACAGCCCACCTGCCCCGGTGGTGGTGAAGAGCGGCTTCAGTCA
GAGTTTTTTTTTGTTTTTTTTTCCCTTCCCTTCCTTCGGACGACATCATCACCTTATGAGCACGGCGGCAGGACC
CTCGACGCGGCCATGTGGTGGGGGATGGGAATCACCGACACGGCGAAGCTGTCGAGAAGCGGGAGGCGAGTGTTT
CTGCATAAGGCGGATGAACTGCTGGCCAGGTTGGAGAGGGTGAGGGAGAGGGCTGCGGGGAGAGCTGAGCCGGGA
GCTGTTGCGGTTGCCATGGTTGAGAAGGAGAAGGAGAAGGAGAAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGGT
GAAGTGAACGGGACGATGAGCATGGACAACGAGATGAACGGAACGACGACCAAAGTTTCGAACCTTGGCAAGACG
AGCCGAGACGACAAGGCCGAGGAAACAAGGCAGACACAGATGCAAGACGACAGGCTAGACGGACCAGAGCTGAAC
AAGCCGAAGCATACGCTGACGCAAGACGCCGAGGTTGGGGAGACGAAGCAGACAACCATGATGCAAGTGTCGTCG
TATCAGACGCATCTCGACAGTCGCCAAGACCACGTCTGCCAACAAGCTGCCGACCAACGAAGCCCAGAGAGCAGC
AAGCTTTCCCCAGCGAGGGAAGCCGGCCACGTCCTCCTTTCGCCATGGCCAGAGACATTCGCCGGCCGACTTGAG
ACCTACCTCGACGCCATGGACTCGGACCAATCCAAAGACGACGGACCCGACCAACTGGCCATGACGCCATCTCAC
CTCGGCCGACTCGACGAAGACATCGGTCAAGTAGCCCACCTTCGGGCGAGCCTGCTAGAGAGCATCAGCCAGCTC
GACAGACGGCGTACCTGCCACTCTGACCGCTGGAAGCGTGCCGGTGGCGCCGCCGACGTCGCCGCCCTCATGAAG
AGCCGTGGTCTGGGTAGCTTGTTGGCCCGGACCGCGGATACGTACCAAGACCAGCCGCCGCGAGATGAATGGGAA
GACTGGTCGTCTCCTCGTTCGGGCCGGTCGAGGCTACGGGGTGCAGAGCAATACTACGGGGGTGCTCCCATCATC
ATCATCATCATCTTCTTCTTCTTCATCATCTTCTTCTTCTTCATCATCATCTTGTTCTTCTTCTTCCTCTTCTTC
TTCTTCATCTTCTTCATCTTCCTCATCATCATCATCATCATCATCATCATCGTCTTCTTCTTCTTCTTCTTGCAG
TCCCGTGTTTCA
Transcript >Ophio5|5771
ATGGCTTTTGATGGCGTCACGCGGCTTCGTCAACAGCCCACCTGCCCCGGTGGTGGTGAAGAGCGGCTTCAGTCA
GAGTTTTTTTTTGTTTTTTTTTCCCTTCCCTTCCTTCGGACGACATCATCACCTTATGAGCACGGCGGCAGGACC
CTCGACGCGGCCATGTGGTGGGGGATGGGAATCACCGACACGGCGAAGCTGTCGAGAAGCGGGAGGCGAGTGTTT
CTGCATAAGGCGGATGAACTGCTGGCCAGGTTGGAGAGGGTGAGGGAGAGGGCTGCGGGGAGAGCTGAGCCGGGA
GCTGTTGCGGTTGCCATGGTTGAGAAGGAGAAGGAGAAGGAGAAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGGT
GAAGTGAACGGGACGATGAGCATGGACAACGAGATGAACGGAACGACGACCAAAGTTTCGAACCTTGGCAAGACG
AGCCGAGACGACAAGGCCGAGGAAACAAGGCAGACACAGATGCAAGACGACAGGCTAGACGGACCAGAGCTGAAC
AAGCCGAAGCATACGCTGACGCAAGACGCCGAGGTTGGGGAGACGAAGCAGACAACCATGATGCAAGTGTCGTCG
TATCAGACGCATCTCGACAGTCGCCAAGACCACGTCTGCCAACAAGCTGCCGACCAACGAAGCCCAGAGAGCAGC
AAGCTTTCCCCAGCGAGGGAAGCCGGCCACGTCCTCCTTTCGCCATGGCCAGAGACATTCGCCGGCCGACTTGAG
ACCTACCTCGACGCCATGGACTCGGACCAATCCAAAGACGACGGACCCGACCAACTGGCCATGACGCCATCTCAC
CTCGGCCGACTCGACGAAGACATCGGTCAAGTAGCCCACCTTCGGGCGAGCCTGCTAGAGAGCATCAGCCAGCTC
GACAGACGGCGTACCTGCCACTCTGACCGCTGGAAGCGTGCCGGTGGCGCCGCCGACGTCGCCGCCCTCATGAAG
AGCCGTGGTCTGGGTAGCTTGTTGGCCCGGACCGCGGATACGTACCAAGACCAGCCGCCGCGAGATGAATGGGAA
GACTGGTCGTCTCCTCGTTCGGGCCGGTCGAGGCTACGGGGTGCAGAGCAATACTACGGGGGTGCTCCCATCATC
ATCATCATCATCTTCTTCTTCTTCATCATCTTCTTCTTCTTCATCATCATCTTGTTCTTCTTCTTCCTCTTCTTC
TTCTTCATCTTCTTCATCTTCCTCATCATCATCATCATCATCATCATCATCGTCTTCTTCTTCTTCTTCTTGCAG
TCCCGTGTTTCATAG
Gene >Ophio5|5771
ATGGCTTTTGATGGCGTCACGCGGCTTCGTCAACAGCCGTCAGTCACTCTCGTGTTGTTTGCGCATGAGGCAGGC
AAACGGCGCTCAGCACCTGCCCCGGTGGTGGTGAAGAGCGGCTTCAGTCAGAGGCACGTTTGTGAGGCCGTCTCC
GTCTCTTTTTTTCTGTTGGCTCTATGCTAGTTTCTTCGGGACGATATGACTAGATTCCTCTGACGCCATCAGTAG
TTTTTTTTTGTTTTTTTTTCCCTTCCCTTCCTTCGGACGACATCATCACCTTATGAGCACGGCGGCAGGACCCTC
GACGCGGCCATGTGGTGGGGGATGGGAATCACCGACACGGCGAAGCTGTCGAGAAGCGGGAGGCGAGTGTTTCTG
CATAAGGCGGATGAACTGCTGGCCAGGTTGGAGAGGGTGAGGGAGAGGGCTGCGGGGAGAGCTGAGCCGGGAGCT
GTTGCGGTTGCCATGGTTGAGAAGGAGAAGGAGAAGGAGAAGGAGGAGGAGGAGGAAGAGGAGGAGGAGGGTGAA
GTGAACGGGACGATGAGCATGGACAACGAGATGAACGGAACGACGACCAAAGTTTCGAACCTTGGCAAGACGAGC
CGAGACGACAAGGCCGAGGAAACAAGGCAGACACAGATGCAAGACGACAGGCTAGACGGACCAGAGCTGAACAAG
CCGAAGCATACGCTGACGCAAGACGCCGAGGTTGGGGAGACGAAGCAGACAACCATGATGCAAGTGTCGTCGTAT
CAGACGCATCTCGACAGTCGCCAAGACCACGTCTGCCAACAAGCTGCCGACCAACGAAGCCCAGAGAGCAGCAAG
CTTTCCCCAGCGAGGGAAGCCGGCCACGTCCTCCTTTCGCCATGGCCAGAGACATTCGCCGGCCGACTTGAGACC
TACCTCGACGCCATGGACTCGGACCAATCCAAAGACGACGGACCCGACCAACTGGCCATGACGCCATCTCACCTC
GGCCGACTCGACGAAGACATCGGTCAAGTAGCCCACCTTCGGGCGAGCCTGCTAGAGAGCATCAGCCAGCTCGAC
AGACGGCGTACCTGCCACTCTGACCGCTGGAAGCGTGCCGGTGGCGCCGCCGACGTCGCCGCCCTCATGAAGAGC
CGTGGTCTGGGTAGCTTGTTGGCCCGGACCGCGGATACGTACCAAGACCAGCCGCCGCGAGATGAATGGGAAGAC
TGGTCGTCTCCTCGTTCGGGCCGGTCGAGGCTACGGGGTGCAGAGCAATACTACGGGGGTAGTGACTGGGCTAAG
AGCGATAGAAACGTCTCCTGGTGATACAGGTGCTCCCATCATCATCATCATCATCTTCTTCTTCTTCATCATCTT
CTTCTTCTTCATCATCATCTTGTTCTTCTTCTTCCTCTTCTTCTTCTTCATCTTCTTCATCTTCCTCATCATCAT
CATCATCATCATCATCATCGTCTTCTTCTTCTTCTTCTTGCAGTCCCGTGTTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail