Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5761
Gene name
Locationscaffold_480:10850..12614
Strand-
Gene length (bp)1764
Transcript length (bp)1764
Coding sequence length (bp)1761
Protein length (aa) 587

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01416 PseudoU_synth_1 tRNA pseudouridine synthase 1.1E-31 292 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 61 498 3.0E-76
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 61 481 9.0E-76
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 61 481 9.0E-72
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 51 425 5.0E-68
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 102 549 5.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 61 498 3.0E-76
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 61 481 9.0E-76
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 61 481 9.0E-72
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 51 425 5.0E-68
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 102 549 5.0E-65
sp|Q09524|TG124_CAEEL Probable tRNA pseudouridine synthase tag-124 OS=Caenorhabditis elegans GN=tag-124 PE=3 SV=1 89 430 8.0E-47
sp|A0B7V0|TRUA_METTP tRNA pseudouridine synthase A OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=truA PE=3 SV=1 105 440 2.0E-24
sp|A4SWX4|TRUA_POLSQ tRNA pseudouridine synthase A OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=truA PE=3 SV=1 105 414 8.0E-18
sp|A9BNH5|TRUA_DELAS tRNA pseudouridine synthase A OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=truA PE=3 SV=1 105 397 7.0E-16
sp|O26928|TRUA_METTH tRNA pseudouridine synthase A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=truA PE=3 SV=1 102 398 1.0E-15
sp|Q8PWT1|TRUA_METMA tRNA pseudouridine synthase A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=truA PE=3 SV=1 105 400 1.0E-15
sp|C4KZL4|TRUA_EXISA tRNA pseudouridine synthase A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=truA PE=3 SV=1 103 425 2.0E-15
sp|B1XV49|TRUA_POLNS tRNA pseudouridine synthase A OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=truA PE=3 SV=1 105 414 3.0E-15
sp|A2SHS6|TRUA_METPP tRNA pseudouridine synthase A OS=Methylibium petroleiphilum (strain PM1) GN=truA PE=3 SV=1 105 407 6.0E-15
sp|A4J151|TRUA_DESRM tRNA pseudouridine synthase A OS=Desulfotomaculum reducens (strain MI-1) GN=truA PE=3 SV=1 105 396 6.0E-14
sp|Q7NUD6|TRUA_CHRVO tRNA pseudouridine synthase A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=truA PE=3 SV=1 105 423 6.0E-14
sp|B8GFU5|TRUA_METPE tRNA pseudouridine synthase A OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=truA PE=3 SV=1 105 418 6.0E-14
sp|Q2NHB4|TRUA_METST tRNA pseudouridine synthase A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=truA PE=3 SV=1 103 449 1.0E-13
sp|A3CXX4|TRUA_METMJ tRNA pseudouridine synthase A OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=truA PE=3 SV=1 105 418 1.0E-13
sp|A8F9B7|TRUA_BACP2 tRNA pseudouridine synthase A OS=Bacillus pumilus (strain SAFR-032) GN=truA PE=3 SV=1 105 423 2.0E-13
sp|Q8XXX8|TRUA_RALSO tRNA pseudouridine synthase A OS=Ralstonia solanacearum (strain GMI1000) GN=truA PE=3 SV=1 105 424 2.0E-13
sp|Q49ZD7|TRUA_STAS1 tRNA pseudouridine synthase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=truA PE=3 SV=1 105 414 3.0E-13
sp|Q8NSV0|TRUA_CORGL tRNA pseudouridine synthase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=truA PE=3 SV=1 105 425 3.0E-13
sp|Q2RFT1|TRUA_MOOTA tRNA pseudouridine synthase A OS=Moorella thermoacetica (strain ATCC 39073) GN=truA PE=3 SV=1 105 395 4.0E-13
sp|B2JQE6|TRUA_BURP8 tRNA pseudouridine synthase A OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=truA PE=3 SV=1 105 395 4.0E-13
sp|Q0K8H3|TRUA_CUPNH tRNA pseudouridine synthase A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=truA PE=3 SV=1 105 395 5.0E-13
sp|A3MBU2|TRUA_BURM7 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10247) GN=truA PE=3 SV=1 105 396 5.0E-13
sp|A2S134|TRUA_BURM9 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10229) GN=truA PE=3 SV=1 105 396 5.0E-13
sp|B6YTJ2|TRUA_THEON tRNA pseudouridine synthase A OS=Thermococcus onnurineus (strain NA1) GN=truA PE=3 SV=1 105 417 5.0E-13
sp|Q63JL6|TRUA_BURPS tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain K96243) GN=truA PE=3 SV=1 105 396 5.0E-13
sp|A3NM70|TRUA_BURP6 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 668) GN=truA PE=3 SV=1 105 396 6.0E-13
sp|Q3JKH3|TRUA_BURP1 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1710b) GN=truA PE=3 SV=1 105 396 6.0E-13
sp|A3P7N2|TRUA_BURP0 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1106a) GN=truA PE=3 SV=1 105 396 6.0E-13
sp|A1UZ38|TRUA_BURMS tRNA pseudouridine synthase A OS=Burkholderia mallei (strain SAVP1) GN=truA PE=3 SV=1 105 396 6.0E-13
sp|Q62AJ2|TRUA_BURMA tRNA pseudouridine synthase A OS=Burkholderia mallei (strain ATCC 23344) GN=truA PE=3 SV=1 105 396 6.0E-13
sp|B2U6Z1|TRUA_RALPJ tRNA pseudouridine synthase A OS=Ralstonia pickettii (strain 12J) GN=truA PE=3 SV=1 105 424 8.0E-13
sp|Q9WU56|TRUA_MOUSE tRNA pseudouridine synthase A, mitochondrial OS=Mus musculus GN=Pus1 PE=1 SV=2 87 391 9.0E-13
sp|A1TLH0|TRUA_ACIAC tRNA pseudouridine synthase A OS=Acidovorax citrulli (strain AAC00-1) GN=truA PE=3 SV=1 105 384 9.0E-13
sp|Q13S27|TRUA_BURXL tRNA pseudouridine synthase A OS=Burkholderia xenovorans (strain LB400) GN=truA PE=3 SV=1 105 384 9.0E-13
sp|Q31HH6|TRUA_THICR tRNA pseudouridine synthase A OS=Thiomicrospira crunogena (strain XCL-2) GN=truA PE=3 SV=1 105 395 9.0E-13
sp|Q8NVB7|TRUA_STAAW tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MW2) GN=truA PE=3 SV=1 105 414 1.0E-12
sp|Q6G7A2|TRUA_STAAS tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MSSA476) GN=truA PE=3 SV=1 105 414 1.0E-12
sp|Q8FS31|TRUA_COREF tRNA pseudouridine synthase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=truA PE=3 SV=2 105 425 1.0E-12
sp|Q2T7H3|TRUA_BURTA tRNA pseudouridine synthase A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=truA PE=3 SV=1 105 396 1.0E-12
sp|Q4KM92|TRUA_RAT tRNA pseudouridine synthase A, mitochondrial OS=Rattus norvegicus GN=Pus1 PE=1 SV=2 87 391 1.0E-12
sp|Q7U376|TRUA_BORPA tRNA pseudouridine synthase A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=truA PE=3 SV=1 105 395 2.0E-12
sp|Q7U386|TRUA_BORBR tRNA pseudouridine synthase A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=truA PE=3 SV=1 105 395 2.0E-12
sp|O87016|TRUA_PSEAE tRNA pseudouridine synthase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=truA PE=3 SV=1 105 388 2.0E-12
sp|A7X5B5|TRUA_STAA1 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=truA PE=3 SV=1 105 414 4.0E-12
sp|P65849|TRUA_STAAN tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain N315) GN=truA PE=3 SV=1 105 414 4.0E-12
sp|A6U3U4|TRUA_STAA2 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH1) GN=truA PE=3 SV=1 105 414 4.0E-12
sp|P65848|TRUA_STAAM tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=truA PE=3 SV=1 105 414 4.0E-12
sp|A5IV03|TRUA_STAA9 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH9) GN=truA PE=3 SV=1 105 414 4.0E-12
sp|A6T009|TRUA_JANMA tRNA pseudouridine synthase A OS=Janthinobacterium sp. (strain Marseille) GN=truA PE=3 SV=1 228 396 4.0E-12
sp|Q9Y606|TRUA_HUMAN tRNA pseudouridine synthase A, mitochondrial OS=Homo sapiens GN=PUS1 PE=1 SV=3 87 391 5.0E-12
sp|A8Z326|TRUA_STAAT tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=truA PE=3 SV=1 105 414 6.0E-12
sp|A6QJ61|TRUA_STAAE tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Newman) GN=truA PE=3 SV=1 105 414 6.0E-12
sp|Q5HDY9|TRUA_STAAC tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain COL) GN=truA PE=3 SV=1 105 414 6.0E-12
sp|Q2FW37|TRUA_STAA8 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain NCTC 8325) GN=truA PE=3 SV=1 105 414 6.0E-12
sp|Q2FES0|TRUA_STAA3 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300) GN=truA PE=3 SV=1 105 414 6.0E-12
sp|Q5JI92|TRUA_THEKO tRNA pseudouridine synthase A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=truA PE=3 SV=1 105 429 6.0E-12
sp|P70973|TRUA_BACSU tRNA pseudouridine synthase A OS=Bacillus subtilis (strain 168) GN=truA PE=3 SV=2 109 423 6.0E-12
sp|A4JMC2|TRUA_BURVG tRNA pseudouridine synthase A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=truA PE=3 SV=1 105 384 1.0E-11
sp|B9MKC1|TRUA_CALBD tRNA pseudouridine synthase A OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=truA PE=3 SV=1 103 396 2.0E-11
sp|B2T9N4|TRUA_BURPP tRNA pseudouridine synthase A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=truA PE=3 SV=1 105 384 2.0E-11
sp|Q6GEL6|TRUA_STAAR tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MRSA252) GN=truA PE=3 SV=1 105 414 3.0E-11
sp|Q2YYM7|TRUA_STAAB tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=truA PE=3 SV=1 105 414 4.0E-11
sp|Q8R7Y7|TRUA_CALS4 tRNA pseudouridine synthase A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=truA PE=3 SV=1 107 396 4.0E-11
sp|A7Z0S0|TRUA_BACMF tRNA pseudouridine synthase A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=truA PE=3 SV=1 105 421 4.0E-11
sp|B3EIU9|TRUA_CHLL2 tRNA pseudouridine synthase A OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=truA PE=3 SV=1 103 421 4.0E-11
sp|Q9RS37|TRUA_DEIRA tRNA pseudouridine synthase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=truA PE=3 SV=1 225 384 8.0E-11
sp|B1MVY3|TRUA_LEUCK tRNA pseudouridine synthase A OS=Leuconostoc citreum (strain KM20) GN=truA PE=3 SV=1 102 397 8.0E-11
sp|B8G6P6|TRUA_CHLAD tRNA pseudouridine synthase A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=truA PE=3 SV=1 103 384 8.0E-11
sp|B5Y955|TRUA_COPPD tRNA pseudouridine synthase A OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=truA PE=3 SV=1 102 399 2.0E-10
sp|B9DM46|TRUA_STACT tRNA pseudouridine synthase A OS=Staphylococcus carnosus (strain TM300) GN=truA PE=3 SV=1 105 456 2.0E-10
sp|C6E4S9|TRUA_GEOSM tRNA pseudouridine synthase A OS=Geobacter sp. (strain M21) GN=truA PE=3 SV=1 103 395 2.0E-10
sp|C5CSH0|TRUA_VARPS tRNA pseudouridine synthase A OS=Variovorax paradoxus (strain S110) GN=truA PE=3 SV=1 105 407 5.0E-10
sp|P60349|TRUA_CORDI tRNA pseudouridine synthase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=truA PE=3 SV=1 102 395 6.0E-10
sp|Q0AGX7|TRUA_NITEC tRNA pseudouridine synthase A OS=Nitrosomonas eutropha (strain C91) GN=truA PE=3 SV=1 105 395 6.0E-10
sp|Q5L3Q7|TRUA_GEOKA tRNA pseudouridine synthase A OS=Geobacillus kaustophilus (strain HTA426) GN=truA PE=3 SV=1 102 423 1.0E-09
sp|B9MDL6|TRUA_ACIET tRNA pseudouridine synthase A OS=Acidovorax ebreus (strain TPSY) GN=truA PE=3 SV=1 105 396 1.0E-09
sp|A1WAT5|TRUA_ACISJ tRNA pseudouridine synthase A OS=Acidovorax sp. (strain JS42) GN=truA PE=3 SV=1 105 396 1.0E-09
sp|Q2JFE6|TRUA_FRASC tRNA pseudouridine synthase A OS=Frankia sp. (strain CcI3) GN=truA PE=3 SV=1 107 441 7.0E-09
sp|Q83WJ5|TRUA_BURM1 tRNA pseudouridine synthase A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=truA PE=3 SV=1 105 414 1.0E-08
sp|Q8CML6|TRUA_STAES tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=truA PE=3 SV=1 226 396 2.0E-08
sp|Q5HM30|TRUA_STAEQ tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=truA PE=3 SV=1 226 396 2.0E-08
sp|Q7U363|TRUA_BORPE tRNA pseudouridine synthase A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=truA PE=3 SV=1 105 395 2.0E-08
sp|A1VRR5|TRUA_POLNA tRNA pseudouridine synthase A OS=Polaromonas naphthalenivorans (strain CJ2) GN=truA PE=3 SV=1 105 395 3.0E-08
sp|Q47HQ7|TRUA_DECAR tRNA pseudouridine synthase A OS=Dechloromonas aromatica (strain RCB) GN=truA PE=3 SV=1 105 407 4.0E-08
sp|Q4L882|TRUA_STAHJ tRNA pseudouridine synthase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=truA PE=3 SV=1 224 396 4.0E-08
sp|A8F526|TRUA_PSELT tRNA pseudouridine synthase A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=truA PE=3 SV=1 103 397 1.0E-07
sp|B1W3X8|TRUA_STRGG tRNA pseudouridine synthase A OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=truA PE=3 SV=1 105 422 4.0E-07
sp|B2GDT8|TRUA_LACF3 tRNA pseudouridine synthase A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=truA PE=3 SV=1 107 384 6.0E-07
sp|A1WSF3|TRUA_VEREI tRNA pseudouridine synthase A OS=Verminephrobacter eiseniae (strain EF01-2) GN=truA PE=3 SV=1 229 395 8.0E-07
sp|Q3A3B5|TRUA_PELCD tRNA pseudouridine synthase A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=truA PE=3 SV=1 228 395 8.0E-07
sp|Q8TWZ3|TRUA_METKA tRNA pseudouridine synthase A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=truA PE=3 SV=1 105 421 1.0E-06
sp|Q393X8|TRUA_BURL3 tRNA pseudouridine synthase A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=truA PE=3 SV=1 105 384 1.0E-06
sp|B6IPI0|TRUA_RHOCS tRNA pseudouridine synthase A OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=truA PE=3 SV=1 107 395 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0009451 RNA modification Yes
GO:0001522 pseudouridine synthesis Yes
GO:0044237 cellular metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016853 isomerase activity No
GO:0016866 intramolecular transferase activity No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1373 0.2009 0.0769 0.063 0.9455 0.068 0.0715 0.0658 0.0867 0.0474

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1563
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6596
Ophiocordyceps australis map64 (Brazil) OphauB2|6124
Ophiocordyceps camponoti-floridani Ophcf2|05820
Ophiocordyceps camponoti-rufipedis Ophun1|739
Ophiocordyceps kimflemingae Ophio5|5761 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5761
MRLSAGGLGPGLRHWIPVGCRLPYPSCRLVSSSRPDRRRTDIRDSMVGDGATYESWTRTGLIRRLRALEAELRTR
PPTEEGTTADLPPTKTKRGVDPSRYSTRYIALKLAYLGKRYGGFEFQAMGNQPTIEEELWNALTRACLVFPDGDD
EAVQFDRCEYSKCGRTDRGVSAFGQVVGLRVRSNRPVRRQKGDDEAIEEEEEEEQEEEEQETRPFDDVADELCYP
YILNRLLPPDIRILAWCPSPPAGFSARFSCRERQYRYFFTQPAFSPRLAPSAGVAPGWLDVKAMRDAAKRFEGEH
DFRNLCKVDPSKQIINFRRRIFEADIVEMENVQSAMPYLQDPEHRLGGDRSHHPKVYYFLVRGSAFLWHQIRHMV
AILFLVGQGLEKPSVVSQLLDVDAHPRKPTYAMADEVPLVLWDCVFPDADVDADVDAKNRFQDALRWIYVGDERP
INKFGPFGVIDGLWRLWRESKMDELLAHQLLMKVEGQGASQRRGDEGDARGKAGVTLFEGGNGGRMAGKYVAVME
KSVTQSPEEQNEKYAKRKGYASAEDMRAQKAIMGRGGETEKGGGGGCRGLSEVREETRDDGS
Coding >Ophio5|5761
ATGCGCCTCTCCGCCGGCGGTCTCGGTCCTGGTCTCCGACACTGGATCCCCGTCGGCTGCAGACTCCCGTATCCG
TCCTGCCGGCTCGTGTCGTCATCGCGGCCTGACCGGCGCAGGACCGACATCCGCGACAGCATGGTAGGCGACGGG
GCAACGTACGAGAGCTGGACGCGGACGGGCCTCATTCGGCGACTGCGCGCGCTCGAGGCCGAGCTGAGGACGCGC
CCGCCGACGGAGGAAGGGACCACGGCGGATCTGCCGCCGACCAAGACGAAGCGCGGCGTCGATCCATCGCGATAC
TCGACCCGCTATATCGCCCTCAAGCTGGCCTACCTCGGCAAGCGGTATGGCGGCTTCGAGTTTCAGGCCATGGGG
AACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGCTGACGAGGGCCTGTCTCGTCTTTCCCGACGGCGACGAC
GAAGCCGTCCAGTTCGACCGCTGCGAGTACTCCAAGTGCGGCCGCACCGATCGCGGCGTCAGCGCCTTTGGCCAG
GTTGTCGGCTTGCGAGTGCGGAGCAACAGGCCGGTTCGCCGCCAAAAAGGAGACGACGAGGCCATCGAGGAGGAA
GAGGAGGAGGAGCAGGAGGAGGAGGAGCAAGAAACGCGGCCATTCGACGACGTTGCCGACGAGCTGTGCTACCCG
TATATCCTCAACCGGCTCCTCCCGCCAGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGGTTTTTCT
GCGCGCTTCTCATGTCGCGAGCGCCAGTACCGCTACTTCTTCACGCAGCCGGCCTTTTCCCCGCGTCTCGCCCCG
TCGGCCGGTGTTGCGCCCGGCTGGCTGGACGTGAAGGCGATGCGCGACGCGGCGAAGCGCTTCGAGGGCGAGCAT
GACTTTCGCAACCTGTGCAAGGTCGATCCGAGCAAGCAGATTATCAACTTTCGCCGGCGCATCTTTGAGGCCGAC
ATCGTCGAGATGGAAAATGTCCAATCAGCGATGCCGTACCTGCAGGACCCGGAACACCGTCTGGGGGGCGACAGA
TCGCATCATCCCAAGGTGTACTACTTTCTCGTCCGGGGCTCGGCCTTTCTGTGGCACCAGATCCGCCACATGGTT
GCTATCCTGTTCCTCGTGGGCCAAGGCCTTGAGAAGCCGTCCGTCGTGTCGCAGCTGCTCGACGTGGACGCCCAC
CCGCGGAAGCCGACGTACGCCATGGCCGACGAGGTGCCGCTCGTCCTATGGGATTGCGTCTTTCCGGATGCGGAC
GTGGATGCGGATGTGGATGCGAAGAACAGGTTCCAAGACGCGCTGCGTTGGATCTACGTCGGTGACGAGCGGCCG
ATCAACAAGTTTGGCCCTTTTGGCGTCATTGATGGGCTGTGGCGGCTGTGGCGCGAGAGTAAGATGGACGAGCTG
CTGGCGCATCAGCTGCTGATGAAGGTTGAGGGCCAGGGGGCGTCGCAGCGCCGAGGTGACGAGGGCGACGCCAGG
GGTAAGGCCGGCGTCACCTTGTTCGAGGGGGGCAACGGCGGAAGGATGGCCGGCAAGTACGTGGCGGTCATGGAG
AAGAGCGTGACGCAGTCGCCCGAGGAGCAGAATGAAAAGTATGCCAAGCGCAAAGGTTATGCGAGCGCCGAGGAC
ATGCGGGCGCAGAAGGCCATCATGGGTCGAGGTGGGGAGACGGAGAAGGGGGGGGGGGGCGGCTGCAGAGGATTG
AGTGAAGTGAGGGAAGAGACGCGGGATGATGGATCA
Transcript >Ophio5|5761
ATGCGCCTCTCCGCCGGCGGTCTCGGTCCTGGTCTCCGACACTGGATCCCCGTCGGCTGCAGACTCCCGTATCCG
TCCTGCCGGCTCGTGTCGTCATCGCGGCCTGACCGGCGCAGGACCGACATCCGCGACAGCATGGTAGGCGACGGG
GCAACGTACGAGAGCTGGACGCGGACGGGCCTCATTCGGCGACTGCGCGCGCTCGAGGCCGAGCTGAGGACGCGC
CCGCCGACGGAGGAAGGGACCACGGCGGATCTGCCGCCGACCAAGACGAAGCGCGGCGTCGATCCATCGCGATAC
TCGACCCGCTATATCGCCCTCAAGCTGGCCTACCTCGGCAAGCGGTATGGCGGCTTCGAGTTTCAGGCCATGGGG
AACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGCTGACGAGGGCCTGTCTCGTCTTTCCCGACGGCGACGAC
GAAGCCGTCCAGTTCGACCGCTGCGAGTACTCCAAGTGCGGCCGCACCGATCGCGGCGTCAGCGCCTTTGGCCAG
GTTGTCGGCTTGCGAGTGCGGAGCAACAGGCCGGTTCGCCGCCAAAAAGGAGACGACGAGGCCATCGAGGAGGAA
GAGGAGGAGGAGCAGGAGGAGGAGGAGCAAGAAACGCGGCCATTCGACGACGTTGCCGACGAGCTGTGCTACCCG
TATATCCTCAACCGGCTCCTCCCGCCAGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGGTTTTTCT
GCGCGCTTCTCATGTCGCGAGCGCCAGTACCGCTACTTCTTCACGCAGCCGGCCTTTTCCCCGCGTCTCGCCCCG
TCGGCCGGTGTTGCGCCCGGCTGGCTGGACGTGAAGGCGATGCGCGACGCGGCGAAGCGCTTCGAGGGCGAGCAT
GACTTTCGCAACCTGTGCAAGGTCGATCCGAGCAAGCAGATTATCAACTTTCGCCGGCGCATCTTTGAGGCCGAC
ATCGTCGAGATGGAAAATGTCCAATCAGCGATGCCGTACCTGCAGGACCCGGAACACCGTCTGGGGGGCGACAGA
TCGCATCATCCCAAGGTGTACTACTTTCTCGTCCGGGGCTCGGCCTTTCTGTGGCACCAGATCCGCCACATGGTT
GCTATCCTGTTCCTCGTGGGCCAAGGCCTTGAGAAGCCGTCCGTCGTGTCGCAGCTGCTCGACGTGGACGCCCAC
CCGCGGAAGCCGACGTACGCCATGGCCGACGAGGTGCCGCTCGTCCTATGGGATTGCGTCTTTCCGGATGCGGAC
GTGGATGCGGATGTGGATGCGAAGAACAGGTTCCAAGACGCGCTGCGTTGGATCTACGTCGGTGACGAGCGGCCG
ATCAACAAGTTTGGCCCTTTTGGCGTCATTGATGGGCTGTGGCGGCTGTGGCGCGAGAGTAAGATGGACGAGCTG
CTGGCGCATCAGCTGCTGATGAAGGTTGAGGGCCAGGGGGCGTCGCAGCGCCGAGGTGACGAGGGCGACGCCAGG
GGTAAGGCCGGCGTCACCTTGTTCGAGGGGGGCAACGGCGGAAGGATGGCCGGCAAGTACGTGGCGGTCATGGAG
AAGAGCGTGACGCAGTCGCCCGAGGAGCAGAATGAAAAGTATGCCAAGCGCAAAGGTTATGCGAGCGCCGAGGAC
ATGCGGGCGCAGAAGGCCATCATGGGTCGAGGTGGGGAGACGGAGAAGGGGGGGGGGGGCGGCTGCAGAGGATTG
AGTGAAGTGAGGGAAGAGACGCGGGATGATGGATCATAA
Gene >Ophio5|5761
ATGCGCCTCTCCGCCGGCGGTCTCGGTCCTGGTCTCCGACACTGGATCCCCGTCGGCTGCAGACTCCCGTATCCG
TCCTGCCGGCTCGTGTCGTCATCGCGGCCTGACCGGCGCAGGACCGACATCCGCGACAGCATGGTAGGCGACGGG
GCAACGTACGAGAGCTGGACGCGGACGGGCCTCATTCGGCGACTGCGCGCGCTCGAGGCCGAGCTGAGGACGCGC
CCGCCGACGGAGGAAGGGACCACGGCGGATCTGCCGCCGACCAAGACGAAGCGCGGCGTCGATCCATCGCGATAC
TCGACCCGCTATATCGCCCTCAAGCTGGCCTACCTCGGCAAGCGGTATGGCGGCTTCGAGTTTCAGGCCATGGGG
AACCAGCCGACCATCGAGGAGGAGCTGTGGAACGCGCTGACGAGGGCCTGTCTCGTCTTTCCCGACGGCGACGAC
GAAGCCGTCCAGTTCGACCGCTGCGAGTACTCCAAGTGCGGCCGCACCGATCGCGGCGTCAGCGCCTTTGGCCAG
GTTGTCGGCTTGCGAGTGCGGAGCAACAGGCCGGTTCGCCGCCAAAAAGGAGACGACGAGGCCATCGAGGAGGAA
GAGGAGGAGGAGCAGGAGGAGGAGGAGCAAGAAACGCGGCCATTCGACGACGTTGCCGACGAGCTGTGCTACCCG
TATATCCTCAACCGGCTCCTCCCGCCAGATATCCGCATCCTGGCCTGGTGTCCCTCGCCGCCGGCCGGTTTTTCT
GCGCGCTTCTCATGTCGCGAGCGCCAGTACCGCTACTTCTTCACGCAGCCGGCCTTTTCCCCGCGTCTCGCCCCG
TCGGCCGGTGTTGCGCCCGGCTGGCTGGACGTGAAGGCGATGCGCGACGCGGCGAAGCGCTTCGAGGGCGAGCAT
GACTTTCGCAACCTGTGCAAGGTCGATCCGAGCAAGCAGATTATCAACTTTCGCCGGCGCATCTTTGAGGCCGAC
ATCGTCGAGATGGAAAATGTCCAATCAGCGATGCCGTACCTGCAGGACCCGGAACACCGTCTGGGGGGCGACAGA
TCGCATCATCCCAAGGTGTACTACTTTCTCGTCCGGGGCTCGGCCTTTCTGTGGCACCAGATCCGCCACATGGTT
GCTATCCTGTTCCTCGTGGGCCAAGGCCTTGAGAAGCCGTCCGTCGTGTCGCAGCTGCTCGACGTGGACGCCCAC
CCGCGGAAGCCGACGTACGCCATGGCCGACGAGGTGCCGCTCGTCCTATGGGATTGCGTCTTTCCGGATGCGGAC
GTGGATGCGGATGTGGATGCGAAGAACAGGTTCCAAGACGCGCTGCGTTGGATCTACGTCGGTGACGAGCGGCCG
ATCAACAAGTTTGGCCCTTTTGGCGTCATTGATGGGCTGTGGCGGCTGTGGCGCGAGAGTAAGATGGACGAGCTG
CTGGCGCATCAGCTGCTGATGAAGGTTGAGGGCCAGGGGGCGTCGCAGCGCCGAGGTGACGAGGGCGACGCCAGG
GGTAAGGCCGGCGTCACCTTGTTCGAGGGGGGCAACGGCGGAAGGATGGCCGGCAAGTACGTGGCGGTCATGGAG
AAGAGCGTGACGCAGTCGCCCGAGGAGCAGAATGAAAAGTATGCCAAGCGCAAAGGTTATGCGAGCGCCGAGGAC
ATGCGGGCGCAGAAGGCCATCATGGGTCGAGGTGGGGAGACGGAGAAGGGGGGGGGGGGCGGCTGCAGAGGATTG
AGTGAAGTGAGGGAAGAGACGCGGGATGATGGATCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail