Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5751
Gene name
Locationscaffold_48:47788..48330
Strand+
Gene length (bp)542
Transcript length (bp)384
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03966 Trm112p Trm112p-like protein 9.4E-18 4 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0S4|TR112_NEUCR Multifunctional methyltransferase subunit trm112 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rmt-1 PE=3 SV=1 1 127 8.0E-68
sp|Q09723|TR112_SCHPO Multifunctional methyltransferase subunit trm112 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm112 PE=3 SV=1 1 122 2.0E-35
sp|P53738|TR112_YEAST Multifunctional methyltransferase subunit TRM112 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM112 PE=1 SV=1 1 127 5.0E-34
sp|Q9C9R3|T112B_ARATH Multifunctional methyltransferase subunit TRM112-like protein At1g78190 OS=Arabidopsis thaliana GN=At1g78190 PE=2 SV=1 1 122 1.0E-22
sp|Q9DCG9|TR112_MOUSE Multifunctional methyltransferase subunit TRM112-like protein OS=Mus musculus GN=Trmt112 PE=1 SV=1 1 122 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0S4|TR112_NEUCR Multifunctional methyltransferase subunit trm112 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rmt-1 PE=3 SV=1 1 127 8.0E-68
sp|Q09723|TR112_SCHPO Multifunctional methyltransferase subunit trm112 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm112 PE=3 SV=1 1 122 2.0E-35
sp|P53738|TR112_YEAST Multifunctional methyltransferase subunit TRM112 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM112 PE=1 SV=1 1 127 5.0E-34
sp|Q9C9R3|T112B_ARATH Multifunctional methyltransferase subunit TRM112-like protein At1g78190 OS=Arabidopsis thaliana GN=At1g78190 PE=2 SV=1 1 122 1.0E-22
sp|Q9DCG9|TR112_MOUSE Multifunctional methyltransferase subunit TRM112-like protein OS=Mus musculus GN=Trmt112 PE=1 SV=1 1 122 2.0E-20
sp|Q2KIA2|TR112_BOVIN Multifunctional methyltransferase subunit TRM112-like protein OS=Bos taurus GN=TRMT112 PE=2 SV=1 1 122 3.0E-20
sp|Q9UI30|TR112_HUMAN Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens GN=TRMT112 PE=1 SV=1 1 122 8.0E-19
sp|Q8LFJ5|T112A_ARATH Multifunctional methyltransferase subunit TRM112-like protein At1g22270 OS=Arabidopsis thaliana GN=At1g22270 PE=2 SV=1 1 122 2.0E-16
sp|Q54N57|TR112_DICDI Multifunctional methyltransferase subunit TRM112-like protein OS=Dictyostelium discoideum GN=DDB_G0285489 PE=3 SV=1 1 122 3.0E-14
sp|O45241|TR112_CAEEL Multifunctional methyltransferase subunit TRM112-like protein OS=Caenorhabditis elegans GN=C04H5.1 PE=3 SV=1 1 121 1.0E-10
sp|Q9VP65|TR112_DROME Multifunctional methyltransferase subunit TRM112-like protein OS=Drosophila melanogaster GN=CG12975 PE=2 SV=1 1 122 7.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5751
MKVLSLNFLTCAVKGCRTSSASYPLHPRDAELVQDDIEINPDMLINLLPRLDWAALRETASELGFPDLPEQPPAL
EQLQADESMLRDLHHLLLETQISEGKLVCGNCGHEYAVKEGIANFLLPSHLV
Coding >Ophio5|5751
ATGAAAGTACTCAGCCTCAACTTCCTCACCTGCGCCGTCAAAGGGTGCAGAACCTCGTCGGCGTCATATCCTCTA
CATCCCAGAGACGCCGAACTGGTGCAGGACGACATCGAAATCAACCCGGACATGCTGATCAACCTGCTACCGCGG
CTAGATTGGGCGGCACTGCGGGAGACGGCCTCGGAGCTGGGATTTCCTGACTTGCCGGAGCAGCCGCCTGCGCTG
GAGCAGCTGCAAGCAGACGAGAGCATGCTACGGGACCTGCACCATCTATTGCTGGAGACGCAGATATCGGAGGGG
AAGCTGGTGTGCGGCAACTGTGGTCATGAGTATGCTGTTAAGGAGGGAATCGCCAACTTTCTCTTGCCGAGCCAC
CTGGTA
Transcript >Ophio5|5751
ATGAAAGTACTCAGCCTCAACTTCCTCACCTGCGCCGTCAAAGGGTGCAGAACCTCGTCGGCGTCATATCCTCTA
CATCCCAGAGACGCCGAACTGGTGCAGGACGACATCGAAATCAACCCGGACATGCTGATCAACCTGCTACCGCGG
CTAGATTGGGCGGCACTGCGGGAGACGGCCTCGGAGCTGGGATTTCCTGACTTGCCGGAGCAGCCGCCTGCGCTG
GAGCAGCTGCAAGCAGACGAGAGCATGCTACGGGACCTGCACCATCTATTGCTGGAGACGCAGATATCGGAGGGG
AAGCTGGTGTGCGGCAACTGTGGTCATGAGTATGCTGTTAAGGAGGGAATCGCCAACTTTCTCTTGCCGAGCCAC
CTGGTATAG
Gene >Ophio5|5751
ATGAAAGTACTCAGCCTCAACTTCCTCACCTGCGCCGTCAAAGGGTGCAGAACCTCGTCGGCGTCATATCCTCTA
CATCCCAGAGACGCCGAACTGGTGCAGGACGACATCGAAATCAACCCGGACATGCTGATCAACCTGCTACCGCGG
CTAGATTGGGCGGCACTGCGGGAGACGGCCTCGGAGGTGCGTTGCGAACCCTTTCCTTCAGGGACAAAAAAAAAA
AAAAAAACCAAACACAGCGGATGCTCTTTTCTCTGGTGAAAAAAAGGCGACGAACGCTTTCTCGTCTAGTTTGAG
ACGAACGGATTGGTAGCCGCGAGCTCAACGCTGACGCGGCGCAGCTGGGATTTCCTGACTTGCCGGAGCAGCCGC
CTGCGCTGGAGCAGCTGCAAGCAGACGAGAGCATGCTACGGGACCTGCACCATCTATTGCTGGAGACGCAGATAT
CGGAGGGGAAGCTGGTGTGCGGCAACTGTGGTCATGAGTATGCTGTTAAGGAGGGAATCGCCAACTTTCTCTTGC
CGAGCCACCTGGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail