Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5744
Gene name
Locationscaffold_48:32064..35508
Strand+
Gene length (bp)3444
Transcript length (bp)2565
Coding sequence length (bp)2562
Protein length (aa) 854

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 489 643 1.0E-12
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 464 708 3.0E-12
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 544 675 2.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 464 682 8.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6467 0.4548 0.1333 0.2895 0.127 0.0693 0.213 0.1328 0.1476 0.0137

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5540
Ophiocordyceps australis map64 (Brazil) OphauB2|3771
Ophiocordyceps camponoti-floridani Ophcf2|04765
Ophiocordyceps camponoti-rufipedis Ophun1|26
Ophiocordyceps kimflemingae Ophio5|5744 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5744
MHRATTDRVPPSPPLPDSGDNQTRLVPPTACFWTVFRSIAIIAPILASHTPPPQASTHRRSALTKRRAWAAHFLS
LPRRRDPHLLSFAQAASSAPDAVSSPSSLVPFFALLKATPHHRAAIHPSTTVLQLINLSEPLSTFFQTLCPYSPC
FYIGLHTPAAGTAANIVVALLSDSIFLRVTSSRPSDLTLRLAFTPTVLSGSSRVKTSPPPPPPPPGCSSYAMPPN
RRITIQPGVESSRSTSHPSEEEESTQYDYNSNTDDDLEDEGDYDEEAVFPSDSASAINELPPSRPRSGRSATRHH
RVSRHEAQYASVQSHALNSPSVDTPEEFNGYYSQPFQPLPAQRGGGGGGGYYNGRGHVHPYPHNHGNHYIGGYPA
GGQMVPYNYGPNPFAPMSNNSSGASYFGAEPRPMYDMMPYQPNFYNPQQYLAAQMQHQLHLTPPAPPATEVPAQP
TSPAPPKEPPVDIEKIKREAEEAAKKLQEDKQKAINDQIEREAQIRKDAEESFRRQLEEAKKQQEEAQRDIARAK
AEADKAAVERIQAEQKAAEERSRLQAEEMKRAEEKAIREYEAKAKAEEERKKRELDERIRIEEAAKAQVHAILKL
EAEAKAKAEKKAAEDAERLKHIQEEAKLKAELDALSKIEADKEAAKKAAEADAAAKKEHEALRKRMMDEAKAKLE
EAAKKTDQGNINFKDAVGRKFNFPYDLVKSWQGMEDLIKQAFLHVEVIGPHVQEGHYDLTGPNGEIILPSIWEKV
IQPDWNISMTMWPVDKRPALGNPKPLFRGRGGPTMPPPPPMGPHGMEPPPEWHPERRRHPHIPNIDIIEVGPHPK
TRKSATKKNSKFSGFFATKKPTKKKTSKK
Coding >Ophio5|5744
ATGCATCGTGCAACAACAGACAGGGTCCCCCCCTCCCCTCCCTTGCCGGACAGCGGCGACAATCAGACTCGGCTC
GTGCCTCCTACCGCCTGCTTCTGGACCGTCTTCCGTTCCATCGCTATTATAGCACCTATCCTGGCTTCACACACC
CCTCCTCCCCAAGCTTCAACTCACCGCCGATCCGCCCTCACCAAGAGACGTGCTTGGGCCGCCCATTTCCTTTCT
CTGCCGAGGCGACGCGACCCGCATCTCCTCTCATTCGCTCAGGCAGCATCCTCGGCCCCCGACGCCGTCTCCTCA
CCCTCGTCCCTCGTCCCCTTCTTCGCCCTACTCAAGGCGACACCACACCACAGAGCCGCAATACATCCTTCCACT
ACTGTCTTGCAGCTCATCAATCTTTCCGAGCCCCTCTCAACTTTCTTTCAAACCCTTTGCCCTTACTCCCCCTGC
TTCTACATAGGCCTTCACACCCCCGCCGCAGGCACAGCCGCAAATATCGTCGTCGCACTGCTGTCGGACTCTATT
TTCTTGCGTGTGACGTCCAGCCGGCCCTCCGACCTGACACTTCGACTTGCCTTTACTCCGACAGTCTTAAGCGGA
TCGTCGCGAGTAAAGACAAGTCCTCCCCCTCCCCCCCCCCCCCCGGGCTGTTCGTCGTATGCTATGCCACCGAAC
AGAAGAATCACAATACAACCCGGTGTCGAGAGTTCGCGCTCGACTTCCCATCCCAGCGAGGAAGAGGAATCAACT
CAATACGACTACAATTCCAATACCGACGACGACTTGGAAGACGAAGGTGACTACGACGAAGAAGCAGTATTTCCG
TCCGACTCTGCTTCCGCCATCAACGAACTGCCACCGTCACGTCCGCGAAGCGGTAGGAGCGCAACTCGGCACCAC
CGAGTCTCACGCCACGAGGCGCAATACGCCTCGGTTCAATCCCACGCCCTGAACTCGCCCAGCGTGGATACCCCC
GAAGAATTCAACGGCTACTATAGCCAGCCGTTCCAGCCTCTGCCCGCCCAACGTGGCGGAGGCGGCGGCGGCGGC
TACTACAATGGGCGCGGCCATGTTCATCCTTACCCACACAACCATGGCAACCACTATATAGGGGGGTATCCTGCC
GGCGGTCAGATGGTTCCCTACAACTACGGTCCGAACCCTTTTGCCCCCATGAGCAACAACTCGAGTGGCGCGAGC
TACTTTGGAGCGGAGCCACGGCCCATGTACGACATGATGCCATACCAGCCCAACTTTTACAACCCGCAACAGTAC
CTGGCCGCCCAGATGCAGCATCAGCTTCATCTTACGCCGCCGGCGCCCCCAGCTACAGAGGTGCCCGCGCAGCCG
ACGAGCCCGGCACCCCCCAAGGAGCCGCCAGTGGATATTGAAAAGATTAAGCGTGAAGCCGAGGAGGCTGCCAAG
AAGCTCCAGGAGGATAAGCAGAAGGCCATAAACGATCAGATCGAGCGGGAAGCGCAGATACGCAAAGACGCCGAG
GAGAGTTTCCGGAGGCAGCTGGAAGAGGCAAAGAAGCAGCAGGAAGAAGCTCAAAGGGATATTGCGCGCGCCAAG
GCCGAGGCCGATAAAGCTGCCGTAGAGAGGATACAAGCCGAACAAAAGGCGGCGGAGGAACGGTCACGCCTGCAA
GCGGAAGAAATGAAGCGTGCCGAGGAAAAGGCGATACGAGAGTACGAGGCTAAGGCCAAGGCCGAAGAGGAGAGG
AAGAAGAGGGAATTGGATGAGCGCATCAGGATTGAGGAGGCTGCAAAGGCTCAGGTCCACGCCATCTTGAAGCTC
GAGGCTGAAGCCAAGGCTAAGGCTGAGAAGAAGGCCGCCGAGGATGCTGAAAGGCTGAAGCATATACAGGAGGAA
GCCAAGCTCAAGGCCGAACTCGATGCCCTGTCCAAGATCGAGGCCGATAAGGAGGCGGCGAAAAAGGCAGCCGAG
GCCGACGCGGCCGCCAAGAAAGAGCACGAGGCTCTCAGGAAGCGGATGATGGACGAGGCCAAAGCAAAGTTGGAG
GAGGCGGCCAAGAAGACCGACCAGGGGAACATCAACTTCAAGGATGCGGTCGGGAGGAAGTTTAACTTTCCTTAC
GATCTAGTCAAGAGCTGGCAGGGCATGGAGGACCTCATCAAGCAGGCCTTTCTTCACGTCGAGGTCATCGGACCG
CACGTTCAAGAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTACCGTCAATATGGGAAAAGGTA
ATCCAGCCGGATTGGAACATCAGTATGACGATGTGGCCGGTGGATAAGAGGCCTGCACTGGGGAATCCCAAGCCC
CTGTTCCGGGGCCGAGGAGGACCGACGATGCCGCCGCCGCCGCCCATGGGCCCGCACGGCATGGAGCCGCCACCG
GAATGGCACCCGGAGAGACGGCGCCATCCGCATATCCCCAACATTGACATCATCGAAGTCGGCCCACATCCCAAG
ACAAGGAAGTCGGCGACCAAGAAAAACTCGAAGTTCTCGGGCTTCTTCGCTACAAAGAAGCCGACCAAGAAAAAA
ACGAGTAAGAAA
Transcript >Ophio5|5744
ATGCATCGTGCAACAACAGACAGGGTCCCCCCCTCCCCTCCCTTGCCGGACAGCGGCGACAATCAGACTCGGCTC
GTGCCTCCTACCGCCTGCTTCTGGACCGTCTTCCGTTCCATCGCTATTATAGCACCTATCCTGGCTTCACACACC
CCTCCTCCCCAAGCTTCAACTCACCGCCGATCCGCCCTCACCAAGAGACGTGCTTGGGCCGCCCATTTCCTTTCT
CTGCCGAGGCGACGCGACCCGCATCTCCTCTCATTCGCTCAGGCAGCATCCTCGGCCCCCGACGCCGTCTCCTCA
CCCTCGTCCCTCGTCCCCTTCTTCGCCCTACTCAAGGCGACACCACACCACAGAGCCGCAATACATCCTTCCACT
ACTGTCTTGCAGCTCATCAATCTTTCCGAGCCCCTCTCAACTTTCTTTCAAACCCTTTGCCCTTACTCCCCCTGC
TTCTACATAGGCCTTCACACCCCCGCCGCAGGCACAGCCGCAAATATCGTCGTCGCACTGCTGTCGGACTCTATT
TTCTTGCGTGTGACGTCCAGCCGGCCCTCCGACCTGACACTTCGACTTGCCTTTACTCCGACAGTCTTAAGCGGA
TCGTCGCGAGTAAAGACAAGTCCTCCCCCTCCCCCCCCCCCCCCGGGCTGTTCGTCGTATGCTATGCCACCGAAC
AGAAGAATCACAATACAACCCGGTGTCGAGAGTTCGCGCTCGACTTCCCATCCCAGCGAGGAAGAGGAATCAACT
CAATACGACTACAATTCCAATACCGACGACGACTTGGAAGACGAAGGTGACTACGACGAAGAAGCAGTATTTCCG
TCCGACTCTGCTTCCGCCATCAACGAACTGCCACCGTCACGTCCGCGAAGCGGTAGGAGCGCAACTCGGCACCAC
CGAGTCTCACGCCACGAGGCGCAATACGCCTCGGTTCAATCCCACGCCCTGAACTCGCCCAGCGTGGATACCCCC
GAAGAATTCAACGGCTACTATAGCCAGCCGTTCCAGCCTCTGCCCGCCCAACGTGGCGGAGGCGGCGGCGGCGGC
TACTACAATGGGCGCGGCCATGTTCATCCTTACCCACACAACCATGGCAACCACTATATAGGGGGGTATCCTGCC
GGCGGTCAGATGGTTCCCTACAACTACGGTCCGAACCCTTTTGCCCCCATGAGCAACAACTCGAGTGGCGCGAGC
TACTTTGGAGCGGAGCCACGGCCCATGTACGACATGATGCCATACCAGCCCAACTTTTACAACCCGCAACAGTAC
CTGGCCGCCCAGATGCAGCATCAGCTTCATCTTACGCCGCCGGCGCCCCCAGCTACAGAGGTGCCCGCGCAGCCG
ACGAGCCCGGCACCCCCCAAGGAGCCGCCAGTGGATATTGAAAAGATTAAGCGTGAAGCCGAGGAGGCTGCCAAG
AAGCTCCAGGAGGATAAGCAGAAGGCCATAAACGATCAGATCGAGCGGGAAGCGCAGATACGCAAAGACGCCGAG
GAGAGTTTCCGGAGGCAGCTGGAAGAGGCAAAGAAGCAGCAGGAAGAAGCTCAAAGGGATATTGCGCGCGCCAAG
GCCGAGGCCGATAAAGCTGCCGTAGAGAGGATACAAGCCGAACAAAAGGCGGCGGAGGAACGGTCACGCCTGCAA
GCGGAAGAAATGAAGCGTGCCGAGGAAAAGGCGATACGAGAGTACGAGGCTAAGGCCAAGGCCGAAGAGGAGAGG
AAGAAGAGGGAATTGGATGAGCGCATCAGGATTGAGGAGGCTGCAAAGGCTCAGGTCCACGCCATCTTGAAGCTC
GAGGCTGAAGCCAAGGCTAAGGCTGAGAAGAAGGCCGCCGAGGATGCTGAAAGGCTGAAGCATATACAGGAGGAA
GCCAAGCTCAAGGCCGAACTCGATGCCCTGTCCAAGATCGAGGCCGATAAGGAGGCGGCGAAAAAGGCAGCCGAG
GCCGACGCGGCCGCCAAGAAAGAGCACGAGGCTCTCAGGAAGCGGATGATGGACGAGGCCAAAGCAAAGTTGGAG
GAGGCGGCCAAGAAGACCGACCAGGGGAACATCAACTTCAAGGATGCGGTCGGGAGGAAGTTTAACTTTCCTTAC
GATCTAGTCAAGAGCTGGCAGGGCATGGAGGACCTCATCAAGCAGGCCTTTCTTCACGTCGAGGTCATCGGACCG
CACGTTCAAGAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTACCGTCAATATGGGAAAAGGTA
ATCCAGCCGGATTGGAACATCAGTATGACGATGTGGCCGGTGGATAAGAGGCCTGCACTGGGGAATCCCAAGCCC
CTGTTCCGGGGCCGAGGAGGACCGACGATGCCGCCGCCGCCGCCCATGGGCCCGCACGGCATGGAGCCGCCACCG
GAATGGCACCCGGAGAGACGGCGCCATCCGCATATCCCCAACATTGACATCATCGAAGTCGGCCCACATCCCAAG
ACAAGGAAGTCGGCGACCAAGAAAAACTCGAAGTTCTCGGGCTTCTTCGCTACAAAGAAGCCGACCAAGAAAAAA
ACGAGTAAGAAATGA
Gene >Ophio5|5744
ATGCATCGTGCAACAACAGACAGGGTCCCCCCCTCCCCTCCCTTGCCGGACAGCGGCGACAATCAGACTCGGGTG
ATGCCGTGCTGGGGACTGGGGGAGAAGCTGCAGACTAGTGAGTGCATGCTCGCGGGCCACGGTTCCCCGTCCGAA
TATCCGCGCCGTGAAGAGCAAGCACCGTCTTGTTGCCCTCTTTATTGGATGCCCTCCATTGGATGCCACATCGCG
AATCGCGACCATCGGTTCTCAACCCACCCTGCTTACGGGATTCGATTTTCCTTGGGTACTTACTGCTTGTGGCAG
AAGCGGCGCCTCTACGATCGGCGTCTGCCTGCACACCTACCTACCACCTACCGATGCTGATAAGAAATTAATAAA
TTAAGACAAAGAAACAAACTATTCGTACGTCCGCGGCTTTTCTCTCCGCCTTCAACCGCCACCCCCTCTCGAGCT
AAGGGTCGTTGCTCCGCGACGGCACCAACAAAGGGCTGCTCGCTTCAGCTGACAGCTCGTGCCTCCTACCGCCTG
CTTCTGGACCGTCTTCCGTTCCATCGCTATTATAGCACCTATCCTGGCTTCACACACCCCTCCTCCCCAAGCTTC
AACTCACCGCCGATCCGCCCTCACCAAGAGACGTGCTTGGGCCGCCCATTTCCTTTCTCTGCCGAGGCGACGCGA
CCCGCATCTCCTCTCATTCGCTCAGGCAGCATCCTCGGCCCCCGACGCCGTCTCCTCACCCTCGTCCCTCGTCCC
CTTCTTCGCCCTACTCAAGGCGACACCACACCACAGAGCCGCAATACATCCTTCCACTACTGTCTTGCAGCTCAT
CAATCTTTCCGAGCCCCTCTCAACTTTCTTTCAAACCCTTTGCCCTTACTCCCCCTGCTTCTACATAGGCCTTCA
CACCCCCGGTCTTTTCTTTCCCCGTCGGCGCCCCCGTGCCTTTGTCCCATGACCAGCCAATCGACTCCTCACGCT
TGTCATTACTTTTTTCCTCCGTCAGCATCTCGCCAGCTCTTTCGTCCACCCTCCCTGTGAGTTGCAGCCGCAGGC
ACAGCCGCAAATATCGTCGTCGCACTGCTGTCGGACTCTATTTTCTTGCGTGGTGAGCGCTCCCACCCCTCTTTT
CTCCTTTAAAATCCTGGTCTCGCCTCTCCTGTCCTCCTACTTTCTCATCGGGTAGCTTGCCTGACGCCGTTCCAG
TGACGTCCAGCCGGCCCTCCGACCTGACACTTCGACTTGCCTTTACTCCGACAGTCTTAAGCGGATCGTCGCGAG
TAAAGACAAGTCCTCCCCCTCCCCCCCCCCCCCCGGGCTGTTCGTCGTATGCTATGCCGTAAGTTTTTAGCCATC
ATTCTCTTCGTCCTTCGAGTGGGGATGCTTGTCGCCGTCTCAACCCACTACCACTGACCAGACTATTCCGAAGAC
CGAACAGAAGAATCACAATACAACCCGGTGTCGAGAGTTCGCGCTCGACTTCCCATCCCAGCGAGGAAGAGGAAT
CAACTCAATACGACTACAATTCCAATACCGACGACGACTTGGAAGACGAAGGTGACTACGACGAAGAAGCAGTAT
TTCCGTCCGACTCTGCTTCCGCCATCAACGAACTGCCACCGTCACGTCCGCGAAGCGGTAGGAGCGCAACTCGGC
ACCACCGAGTCTCACGCCACGAGGCGCAATACGCCTCGGTTCAATCCCACGCCCTGAACTCGCCCAGCGTGGATA
CCCCCGAAGAATTCAACGGCTACTATAGCCAGCCGTTCCAGCCTCTGCCCGCCCAACGTGGCGGAGGCGGCGGCG
GCGGCTACTACAATGGGCGCGGCCATGTTCATCCTTACCCACACAACCATGGCAACCACTATATAGGGGGGTATC
CTGCCGGCGGTCAGATGGTTCCCTACAACTACGGTCCGAACCCTTTTGCCCCCATGAGCAACAACTCGAGTGGCG
CGAGCTACTTTGGAGCGGAGCCACGGCCCATGTACGACATGATGCCATACCAGCCCAACTTTTACAACCCGCAAC
AGTACCTGGCCGCCCAGATGCAGCATCAGCTTCATCTTACGCCGCCGGCGCCCCCAGCTACAGAGGTGCCCGCGC
AGCCGACGAGCCCGGCACCCCCCAAGGAGCCGCCAGTGGATATTGAAAAGATTAAGCGTGAAGCCGAGGAGGCTG
CCAAGAAGCTCCAGGAGGATAAGCAGAAGGCCATAAACGATCAGATCGAGCGGGAAGCGCAGATACGCAAAGACG
CCGAGGAGAGTTTCCGGAGGCAGCTGGAAGAGGCAAAGAAGCAGCAGGAAGAAGCTCAAAGGGATATTGCGCGCG
CCAAGGCCGAGGCCGATAAAGCTGCCGTAGAGAGGATACAAGCCGAACAAAAGGCGGCGGAGGAACGGTCACGCC
TGCAAGCGGAAGAAATGAAGCGTGCCGAGGAAAAGGCGATACGAGAGTACGAGGCTAAGGCCAAGGCCGAAGAGG
AGAGGAAGAAGAGGGAATTGGATGAGCGCATCAGGATTGAGGAGGCTGCAAAGGCTCAGGTCCACGCCATCTTGA
AGCTCGAGGCTGAAGCCAAGGCTAAGGCTGAGAAGAAGGCCGCCGAGGATGCTGAAAGGCTGAAGCATATACAGG
AGGAAGCCAAGCTCAAGGCCGAACTCGATGCCCTGTCCAAGATCGAGGCCGATAAGGAGGCGGCGAAAAAGGCAG
CCGAGGCCGACGCGGCCGCCAAGAAAGAGCACGAGGCTCTCAGGAAGCGGATGATGGACGAGGCCAAAGCAAAGT
TGGAGGAGGCGGCCAAGAAGACCGACCAGGGGAACATCAACTTCAAGGATGCGGTCGGGAGGAAGTTTAACTTTC
CTTACGATCTAGTCAAGAGCTGGCAGGTAAGTTTGCGACAGCCATCCCCTTTTCCCGGGCTTCCGTGTACTAACC
CGGCGTTTGCAGGGCATGGAGGACCTCATCAAGCAGGCCTTTCTTCACGTCGAGGTCATCGGACCGCACGTTCAA
GAGGGCCACTACGACTTGACCGGGCCCAACGGCGAGATCATTCTACCGTCAATATGGGAAAAGGTAATCCAGCCG
GATTGGAACATCAGTATGACGATGTGGCCGGTGGATAAGAGGCCTGCACTGGGGAATCCCAAGCCCCTGTTCCGG
GGCCGAGGAGGACCGACGATGCCGCCGCCGCCGCCCATGGGCCCGCACGGCATGGAGCCGCCACCGGAATGGCAC
CCGGAGAGACGGCGCCATCCGCATATCCCCAACATTGACATCATCGAAGTCGGCCCACATCCCAAGACAAGGAAG
TCGGCGACCAAGAAAAACTCGAAGTTCTCGGGCTTCTTCGCTACAAAGAAGCCGACCAAGAAAAAGTAAGGGGAT
GCGGATGCCAGAGTCGCCGTGTCCGGTCTTGTGCTGACAGCAGTCTGGATTAGAACGAGTAAGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail