Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5731
Gene name
Locationscaffold_48:1163..3086
Strand-
Gene length (bp)1923
Transcript length (bp)1731
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12929 Mid1 Stretch-activated Ca2+-permeable channel component 3.7E-78 138 439
PF12929 Mid1 Stretch-activated Ca2+-permeable channel component 1.3E-28 450 544

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10063|EHS1_SCHPO Calcium influx-promoting protein ehs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehs1 PE=3 SV=1 69 540 8.0E-37
sp|P41821|MID1_YEAST Stretch-activated cation channel MID1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MID1 PE=1 SV=1 214 545 1.0E-24

GO

GO Term Description Terminal node
GO:0098703 calcium ion import across plasma membrane Yes
GO:0005262 calcium channel activity Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0005215 transporter activity No
GO:0034220 ion transmembrane transport No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0022803 passive transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0051234 establishment of localization No
GO:0015085 calcium ion transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0005216 ion channel activity No
GO:0008150 biological_process No
GO:0098657 import into cell No
GO:0046873 metal ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005261 cation channel activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0006816 calcium ion transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0098659 inorganic cation import across plasma membrane No
GO:0030001 metal ion transport No
GO:0099587 inorganic ion import across plasma membrane No
GO:0098739 import across plasma membrane No
GO:0097553 calcium ion transmembrane import into cytosol No
GO:0070588 calcium ion transmembrane transport No
GO:0009987 cellular process No
GO:0015267 channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 56.53 30.68 82.37
CcL In ants, during behavior modification 66.29 36.27 96.30
CcD In ants, recently dead 65.29 35.64 94.94

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.532955 no
SC16a CcD 0.575419 no
CcL CcD 0.959564 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5731
MVSTTKRLAPSWATSLAPSWATSLALLLLVASASVSCSPSHDGVTPATADMALAQSDILGRTPTYESDFFALDRS
IVGRATTVVSTLTKNQAVALNLQPGSTACYMVQREAMFGDDGDGNGRPGRNPSQPNAEARSPTLYLSANTCLQPS
HASSDSKKKTGTPQLILAVSNSSETACKNSATLPKDGEGKTFTEGAVMFSLNMTGDLFVGITAPNVSSDFRGIYN
FELGASPDDFLHRYEGEDRSELLWMDSDSTSAILATRNLTEDESEITRVMNQALPYELYVSNDEALSSAGLRHSY
CGLRNTAQIRASQSSNSEANSPVKTVVTRRGPGGFPKQQFHFVSLNASSRYTGILVKKPREDGLGKRQDNAADSG
PGSVVFRATEFETITGSSCKIVTDLEFCDEIQYAVPGNDRRFNNTALGKAYDDYARKMYANFEKPTRSGYAPSVC
RDFPNGTQLAPEVRGPLEQRPPTNSSRNRFIDEEIQPGPYKEILPCEDLCYEVVQSCPARIGFKCPRPEFPGFDT
SYGRRDQDPATVSCNFAGEARTPISGGKGLLPELGWAGGVSLVVAAAQVLR
Coding >Ophio5|5731
ATGGTGTCGACGACGAAGCGGCTGGCGCCATCGTGGGCGACCTCGCTGGCGCCATCGTGGGCGACCTCGCTGGCG
CTGCTGCTTCTCGTCGCCTCGGCCTCGGTGTCTTGTTCGCCATCACACGATGGCGTCACGCCGGCGACAGCTGAC
ATGGCGCTCGCACAGTCCGACATACTTGGCCGCACGCCGACATACGAGTCCGATTTCTTCGCCCTGGACCGCAGT
ATCGTCGGACGCGCGACGACGGTCGTCTCGACGCTGACCAAGAACCAGGCCGTGGCGCTGAATTTACAGCCCGGG
TCGACGGCGTGCTACATGGTGCAGAGGGAGGCCATGTTCGGCGACGACGGAGACGGTAATGGCCGGCCAGGGCGC
AACCCGTCGCAGCCCAACGCCGAGGCGAGGTCCCCGACGCTCTACCTCTCGGCAAACACCTGTCTGCAGCCGAGC
CACGCGTCATCGGATAGCAAGAAGAAGACGGGTACGCCGCAGCTGATATTGGCCGTATCCAATTCGAGCGAGACG
GCGTGCAAAAACTCGGCGACGCTACCCAAGGATGGCGAGGGCAAGACTTTCACCGAGGGTGCCGTCATGTTCAGT
CTGAATATGACGGGCGACCTCTTCGTCGGCATCACGGCGCCAAACGTCTCGTCTGACTTCCGCGGCATCTACAAC
TTCGAGCTGGGTGCCTCGCCCGACGACTTTCTGCATCGGTACGAGGGCGAAGACCGGTCCGAGCTACTATGGATG
GACAGCGACTCGACGTCGGCCATCCTCGCCACCCGCAACCTAACCGAGGACGAGTCCGAGATCACGCGCGTCATG
AATCAGGCGCTGCCCTACGAATTGTACGTCAGCAACGACGAGGCACTCTCCAGCGCCGGGCTGAGACACTCGTAC
TGTGGGCTACGAAACACGGCTCAGATCCGGGCGAGCCAGTCGAGCAACAGCGAAGCCAACAGCCCCGTCAAGACA
GTCGTCACCCGCAGGGGACCTGGGGGGTTCCCCAAGCAGCAATTCCACTTTGTCTCCCTCAATGCCAGCTCCAGG
TACACGGGCATCCTGGTCAAGAAACCGCGTGAAGACGGCTTGGGCAAGAGGCAGGATAATGCGGCGGATTCCGGC
CCGGGAAGCGTTGTCTTCCGAGCGACTGAGTTCGAGACCATCACCGGATCCAGCTGTAAGATCGTGACGGACCTC
GAGTTCTGCGACGAGATCCAGTACGCGGTGCCGGGCAATGACCGGCGCTTCAACAACACGGCGCTGGGCAAAGCT
TACGACGACTACGCCCGAAAGATGTACGCCAACTTTGAAAAGCCTACAAGAAGTGGCTATGCACCGTCAGTATGC
CGCGATTTTCCCAACGGCACGCAGCTGGCTCCGGAAGTGCGAGGGCCGTTGGAGCAGAGGCCTCCTACCAACTCG
TCTCGCAACCGGTTCATCGACGAGGAGATACAGCCGGGGCCATACAAGGAGATCCTGCCGTGCGAGGACCTCTGC
TACGAGGTGGTGCAGAGCTGTCCGGCCAGGATCGGCTTCAAGTGTCCGCGTCCCGAGTTTCCGGGCTTCGACACA
AGCTACGGGCGGAGAGACCAGGATCCGGCGACGGTGTCGTGCAACTTTGCCGGCGAGGCGCGGACGCCGATAAGT
GGTGGCAAGGGACTTCTTCCCGAGCTGGGGTGGGCTGGGGGCGTTTCTCTCGTCGTGGCGGCGGCGCAGGTGTTG
AGG
Transcript >Ophio5|5731
ATGGTGTCGACGACGAAGCGGCTGGCGCCATCGTGGGCGACCTCGCTGGCGCCATCGTGGGCGACCTCGCTGGCG
CTGCTGCTTCTCGTCGCCTCGGCCTCGGTGTCTTGTTCGCCATCACACGATGGCGTCACGCCGGCGACAGCTGAC
ATGGCGCTCGCACAGTCCGACATACTTGGCCGCACGCCGACATACGAGTCCGATTTCTTCGCCCTGGACCGCAGT
ATCGTCGGACGCGCGACGACGGTCGTCTCGACGCTGACCAAGAACCAGGCCGTGGCGCTGAATTTACAGCCCGGG
TCGACGGCGTGCTACATGGTGCAGAGGGAGGCCATGTTCGGCGACGACGGAGACGGTAATGGCCGGCCAGGGCGC
AACCCGTCGCAGCCCAACGCCGAGGCGAGGTCCCCGACGCTCTACCTCTCGGCAAACACCTGTCTGCAGCCGAGC
CACGCGTCATCGGATAGCAAGAAGAAGACGGGTACGCCGCAGCTGATATTGGCCGTATCCAATTCGAGCGAGACG
GCGTGCAAAAACTCGGCGACGCTACCCAAGGATGGCGAGGGCAAGACTTTCACCGAGGGTGCCGTCATGTTCAGT
CTGAATATGACGGGCGACCTCTTCGTCGGCATCACGGCGCCAAACGTCTCGTCTGACTTCCGCGGCATCTACAAC
TTCGAGCTGGGTGCCTCGCCCGACGACTTTCTGCATCGGTACGAGGGCGAAGACCGGTCCGAGCTACTATGGATG
GACAGCGACTCGACGTCGGCCATCCTCGCCACCCGCAACCTAACCGAGGACGAGTCCGAGATCACGCGCGTCATG
AATCAGGCGCTGCCCTACGAATTGTACGTCAGCAACGACGAGGCACTCTCCAGCGCCGGGCTGAGACACTCGTAC
TGTGGGCTACGAAACACGGCTCAGATCCGGGCGAGCCAGTCGAGCAACAGCGAAGCCAACAGCCCCGTCAAGACA
GTCGTCACCCGCAGGGGACCTGGGGGGTTCCCCAAGCAGCAATTCCACTTTGTCTCCCTCAATGCCAGCTCCAGG
TACACGGGCATCCTGGTCAAGAAACCGCGTGAAGACGGCTTGGGCAAGAGGCAGGATAATGCGGCGGATTCCGGC
CCGGGAAGCGTTGTCTTCCGAGCGACTGAGTTCGAGACCATCACCGGATCCAGCTGTAAGATCGTGACGGACCTC
GAGTTCTGCGACGAGATCCAGTACGCGGTGCCGGGCAATGACCGGCGCTTCAACAACACGGCGCTGGGCAAAGCT
TACGACGACTACGCCCGAAAGATGTACGCCAACTTTGAAAAGCCTACAAGAAGTGGCTATGCACCGTCAGTATGC
CGCGATTTTCCCAACGGCACGCAGCTGGCTCCGGAAGTGCGAGGGCCGTTGGAGCAGAGGCCTCCTACCAACTCG
TCTCGCAACCGGTTCATCGACGAGGAGATACAGCCGGGGCCATACAAGGAGATCCTGCCGTGCGAGGACCTCTGC
TACGAGGTGGTGCAGAGCTGTCCGGCCAGGATCGGCTTCAAGTGTCCGCGTCCCGAGTTTCCGGGCTTCGACACA
AGCTACGGGCGGAGAGACCAGGATCCGGCGACGGTGTCGTGCAACTTTGCCGGCGAGGCGCGGACGCCGATAAGT
GGTGGCAAGGGACTTCTTCCCGAGCTGGGGTGGGCTGGGGGCGTTTCTCTCGTCGTGGCGGCGGCGCAGGTGTTG
AGGTAG
Gene >Ophio5|5731
ATGGTGTCGACGACGAAGCGGCTGGCGCCATCGTGGGCGACCTCGCTGGCGCCATCGTGGGCGACCTCGCTGGCG
CTGCTGCTTCTCGTCGCCTCGGCCTCGGTGTCTTGTTCGCCATCACACGATGGCGTCACGCCGGCGACAGCTGAC
ATGGCGCTCGCACAGTCCGACATACTTGGCCGCACGCCGACATACGAGTCCGATTTCTTCGCCCTGGACCGCAGT
ATCGTCGGACGCGCGACGACGGTCGTCTCGACGCTGACCAAGAACCAGGCCGTGGCGCTGAATTTACAGCCCGGG
TCGACGGCGTGCTACATGGTGCAGAGGGAGGCCATGTTCGGCGACGACGGAGACGGTAATGGCCGGCCAGGGCGC
AACCCGTCGCAGCCCAACGCCGAGGCGAGGTCCCCGACGCTCTACCTCTCGGCAAACACCTGTCTGCAGCCGAGC
CACGCGTCATCGGATAGCAAGAAGAAGACGGGTACGCCGCAGCTGATATTGGCCGTATCCAATTCGAGCGAGACG
GCGTGCAAAAACTCGGCGACGCTACCCAAGGATGGCGAGGGCAAGACTTTCACCGAGGGTGCCGTCATGTTCAGT
CTGAATATGACGGGCGACCTCTTCGTCGGCATCACGGCGCCAAACGTCTCGTCTGACTTCCGCGGCATCTACAAC
TTCGAGCTGGGTGCCTCGCCCGACGACTTTCTGCATCGGTACGAGGGCGAAGACCGGTCCGAGCTACTATGGATG
GACAGCGACTCGACGTCGGCCATCCTCGCCACCCGCAACCTAACCGAGGACGAGTCCGAGATCACGCGCGTCATG
AATCAGGCGCTGCCCTACGAATTGTACGTCAGCAACGACGAGGCACTCTCCAGCGCCGGGCTGAGACACTCGTAC
TGTGGGCTACGAAACACGGCTCAGATCCGGGCGAGCCAGTCGAGCAACAGCGAAGCCAACAGCCCCGTCAAGACA
GTCGTCACCCGCAGGGGACCTGGGGGGTTCCCCAAGCAGCAATTCCACTTTGTCTCCCTCAATGCCAGCTCCAGG
TACACGGGCATCCTGGTCAAGAAACCGCGTGAAGACGGCTTGGGCAAGAGGCAGGATAATGCGGCGGATTCCGGC
CCGGGAAGCGTTGTCTTCCGAGCGACTGAGTTCGAGACCATCACCGGTAGGTTCGGCGCATCTCGCTGTCTCCGC
AAGCAAGCAGCTGACGATGGAACAGGATCCAGCTGTAAGATCGTGACGGACCTCGAGTTCTGCGACGAGATCCAG
TACGCGGTGCCGGGCAATGACCGGCGCTTCAACAACACGGCGCTGGGCAAAGCTTACGACGACTACGCCCGAAAG
ATGTACGCCAACTTTGAAAAGGTGATGATGCAGATACCGTGCGAGGCGCCGCGGACGTCCATGTACTCACTCGTC
CGCACCTGCGAGGACTGCAAGGTAGCCTACAAGAAGTGGCTATGCACCGTCAGTATGCCGCGGTGCGAGGACTTT
GCCAGTAGCAAAAACCGGTTCGCGCTGGCACGCAACGCGGCACAAGATTTTCCCAACGGCACGCAGCTGGCTCCG
GAAGTGCGAGGGCCGTTGGAGCAGAGGCCTCCTACCAACTCGTCTCGCAACCGGTTCATCGACGAGGAGATACAG
CCGGGGCCATACAAGGAGATCCTGCCGTGCGAGGACCTCTGCTACGAGGTGGTGCAGAGCTGTCCGGCCAGGATC
GGCTTCAAGTGTCCGCGTCCCGAGTTTCCGGGCTTCGACACAAGCTACGGGCGGAGAGACCAGGATCCGGCGACG
GTGTCGTGCAACTTTGCCGGCGAGGCGCGGACGCCGATAAGTGGTGGCAAGGGACTTCTTCCCGAGCTGGGGTGG
GCTGGGGGCGTTTCTCTCGTCGTGGCGGCGGCGCAGGTGTTGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail