Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5727
Gene name
Locationscaffold_479:3492..4707
Strand-
Gene length (bp)1215
Transcript length (bp)1215
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8I335|GUF1_PLAF7 Translation factor GUF1 homolog, mitochondrial OS=Plasmodium falciparum (isolate 3D7) GN=PFI0570w PE=3 SV=1 134 237 4.0E-11
sp|Q8I335|GUF1_PLAF7 Translation factor GUF1 homolog, mitochondrial OS=Plasmodium falciparum (isolate 3D7) GN=PFI0570w PE=3 SV=1 114 252 1.0E-10
sp|Q8I335|GUF1_PLAF7 Translation factor GUF1 homolog, mitochondrial OS=Plasmodium falciparum (isolate 3D7) GN=PFI0570w PE=3 SV=1 162 281 4.0E-08
sp|Q8I335|GUF1_PLAF7 Translation factor GUF1 homolog, mitochondrial OS=Plasmodium falciparum (isolate 3D7) GN=PFI0570w PE=3 SV=1 164 276 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5727
MKFFLTIVTVFVGIATAAPAQRPEPVRKLPDQVPSQNSQQDEAAFNVTRRAATGKDSAAAIGAQNPAAGIGAQNP
ATAIGTPNPAAAIGAPNPAAIGLQNPAAAIGVDQDPTTGQDRAAARRAEREARRAARRQGRAGANGLDQADAGGL
AQADVDGQDQTDARGQDRANANGQDNTAANGQGKTAANGQGKAAANGQGKTAANGQGKTAANGQGNTAANGQDKT
AANEQGKAAANKQDRAGAKGQDGANANEQGRPVINGQDKTTTKGQTQAASNEQVQTAVLGASQGQQQQQEVSTAV
EKAAKLSRRQLDGFGGFGGLGGGLGGSGLGGGLGGGLGGGLGGGLGGLEGGLGVGPGAGSLGLGPGFSGGLAGTG
GGFGVGLGGLGTGAGGLGAGAGQLNSLFL
Coding >Ophio5|5727
ATGAAGTTCTTTTTAACAATCGTCACTGTTTTCGTCGGGATAGCTACTGCTGCACCCGCTCAGCGCCCAGAACCT
GTCAGGAAACTGCCTGATCAAGTTCCATCACAAAACAGCCAACAAGATGAAGCTGCTTTCAACGTGACACGCCGA
GCTGCCACTGGAAAAGACTCCGCTGCTGCCATTGGAGCGCAGAACCCAGCTGCCGGCATTGGAGCGCAGAACCCA
GCTACTGCCATTGGAACACCGAATCCAGCTGCTGCTATTGGAGCACCGAACCCAGCTGCCATTGGATTGCAAAAC
CCAGCGGCTGCCATTGGAGTTGACCAGGATCCTACCACTGGACAGGACCGAGCTGCTGCCAGGAGAGCAGAGCGG
GAAGCAAGACGAGCTGCCCGCAGACAAGGTCGAGCCGGTGCCAACGGCCTAGACCAAGCTGATGCCGGTGGACTC
GCCCAAGCTGATGTCGACGGACAAGACCAAACTGATGCCAGAGGACAAGACCGAGCTAATGCCAACGGACAAGAC
AACACTGCTGCCAACGGTCAAGGCAAAACTGCTGCCAATGGACAAGGCAAGGCTGCTGCCAATGGACAAGGCAAA
ACTGCTGCCAACGGACAAGGCAAAACTGCTGCCAATGGACAAGGCAACACTGCTGCCAACGGTCAAGACAAAACT
GCTGCCAATGAACAAGGCAAGGCTGCCGCCAATAAACAAGATCGAGCCGGTGCCAAGGGACAAGACGGAGCTAAT
GCCAACGAACAAGGTCGGCCCGTCATCAACGGACAAGACAAAACCACGACCAAGGGACAAACCCAAGCAGCCTCC
AACGAACAAGTCCAAACCGCCGTCCTGGGCGCTTCCCAAGGCCAACAACAACAACAAGAAGTCTCGACGGCAGTC
GAGAAAGCGGCCAAGCTCTCCCGTCGACAACTAGACGGCTTCGGCGGCTTCGGCGGCTTAGGCGGAGGCCTGGGA
GGCAGTGGTCTAGGCGGTGGTCTAGGCGGTGGTCTCGGCGGTGGTCTAGGCGGTGGTCTAGGCGGCCTTGAAGGC
GGTTTGGGAGTCGGTCCGGGTGCCGGCAGTCTGGGCCTCGGGCCAGGTTTTTCCGGTGGGCTCGCCGGCACAGGA
GGTGGCTTCGGCGTTGGCCTGGGAGGTCTGGGTACAGGGGCTGGAGGTCTTGGAGCAGGAGCAGGACAACTGAAC
AGTCTCTTTCTT
Transcript >Ophio5|5727
ATGAAGTTCTTTTTAACAATCGTCACTGTTTTCGTCGGGATAGCTACTGCTGCACCCGCTCAGCGCCCAGAACCT
GTCAGGAAACTGCCTGATCAAGTTCCATCACAAAACAGCCAACAAGATGAAGCTGCTTTCAACGTGACACGCCGA
GCTGCCACTGGAAAAGACTCCGCTGCTGCCATTGGAGCGCAGAACCCAGCTGCCGGCATTGGAGCGCAGAACCCA
GCTACTGCCATTGGAACACCGAATCCAGCTGCTGCTATTGGAGCACCGAACCCAGCTGCCATTGGATTGCAAAAC
CCAGCGGCTGCCATTGGAGTTGACCAGGATCCTACCACTGGACAGGACCGAGCTGCTGCCAGGAGAGCAGAGCGG
GAAGCAAGACGAGCTGCCCGCAGACAAGGTCGAGCCGGTGCCAACGGCCTAGACCAAGCTGATGCCGGTGGACTC
GCCCAAGCTGATGTCGACGGACAAGACCAAACTGATGCCAGAGGACAAGACCGAGCTAATGCCAACGGACAAGAC
AACACTGCTGCCAACGGTCAAGGCAAAACTGCTGCCAATGGACAAGGCAAGGCTGCTGCCAATGGACAAGGCAAA
ACTGCTGCCAACGGACAAGGCAAAACTGCTGCCAATGGACAAGGCAACACTGCTGCCAACGGTCAAGACAAAACT
GCTGCCAATGAACAAGGCAAGGCTGCCGCCAATAAACAAGATCGAGCCGGTGCCAAGGGACAAGACGGAGCTAAT
GCCAACGAACAAGGTCGGCCCGTCATCAACGGACAAGACAAAACCACGACCAAGGGACAAACCCAAGCAGCCTCC
AACGAACAAGTCCAAACCGCCGTCCTGGGCGCTTCCCAAGGCCAACAACAACAACAAGAAGTCTCGACGGCAGTC
GAGAAAGCGGCCAAGCTCTCCCGTCGACAACTAGACGGCTTCGGCGGCTTCGGCGGCTTAGGCGGAGGCCTGGGA
GGCAGTGGTCTAGGCGGTGGTCTAGGCGGTGGTCTCGGCGGTGGTCTAGGCGGTGGTCTAGGCGGCCTTGAAGGC
GGTTTGGGAGTCGGTCCGGGTGCCGGCAGTCTGGGCCTCGGGCCAGGTTTTTCCGGTGGGCTCGCCGGCACAGGA
GGTGGCTTCGGCGTTGGCCTGGGAGGTCTGGGTACAGGGGCTGGAGGTCTTGGAGCAGGAGCAGGACAACTGAAC
AGTCTCTTTCTTTAA
Gene >Ophio5|5727
ATGAAGTTCTTTTTAACAATCGTCACTGTTTTCGTCGGGATAGCTACTGCTGCACCCGCTCAGCGCCCAGAACCT
GTCAGGAAACTGCCTGATCAAGTTCCATCACAAAACAGCCAACAAGATGAAGCTGCTTTCAACGTGACACGCCGA
GCTGCCACTGGAAAAGACTCCGCTGCTGCCATTGGAGCGCAGAACCCAGCTGCCGGCATTGGAGCGCAGAACCCA
GCTACTGCCATTGGAACACCGAATCCAGCTGCTGCTATTGGAGCACCGAACCCAGCTGCCATTGGATTGCAAAAC
CCAGCGGCTGCCATTGGAGTTGACCAGGATCCTACCACTGGACAGGACCGAGCTGCTGCCAGGAGAGCAGAGCGG
GAAGCAAGACGAGCTGCCCGCAGACAAGGTCGAGCCGGTGCCAACGGCCTAGACCAAGCTGATGCCGGTGGACTC
GCCCAAGCTGATGTCGACGGACAAGACCAAACTGATGCCAGAGGACAAGACCGAGCTAATGCCAACGGACAAGAC
AACACTGCTGCCAACGGTCAAGGCAAAACTGCTGCCAATGGACAAGGCAAGGCTGCTGCCAATGGACAAGGCAAA
ACTGCTGCCAACGGACAAGGCAAAACTGCTGCCAATGGACAAGGCAACACTGCTGCCAACGGTCAAGACAAAACT
GCTGCCAATGAACAAGGCAAGGCTGCCGCCAATAAACAAGATCGAGCCGGTGCCAAGGGACAAGACGGAGCTAAT
GCCAACGAACAAGGTCGGCCCGTCATCAACGGACAAGACAAAACCACGACCAAGGGACAAACCCAAGCAGCCTCC
AACGAACAAGTCCAAACCGCCGTCCTGGGCGCTTCCCAAGGCCAACAACAACAACAAGAAGTCTCGACGGCAGTC
GAGAAAGCGGCCAAGCTCTCCCGTCGACAACTAGACGGCTTCGGCGGCTTCGGCGGCTTAGGCGGAGGCCTGGGA
GGCAGTGGTCTAGGCGGTGGTCTAGGCGGTGGTCTCGGCGGTGGTCTAGGCGGTGGTCTAGGCGGCCTTGAAGGC
GGTTTGGGAGTCGGTCCGGGTGCCGGCAGTCTGGGCCTCGGGCCAGGTTTTTCCGGTGGGCTCGCCGGCACAGGA
GGTGGCTTCGGCGTTGGCCTGGGAGGTCTGGGTACAGGGGCTGGAGGTCTTGGAGCAGGAGCAGGACAACTGAAC
AGTCTCTTTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail