Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5720
Gene name
Locationscaffold_478:6306..7906
Strand-
Gene length (bp)1600
Transcript length (bp)1416
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.2E-10 3 247
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.9E-06 6 36
PF01134 GIDA Glucose inhibited division protein A 5.4E-06 3 134
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.6E-05 3 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GQG8|KMO_CHAGB Kynurenine 3-monooxygenase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BNA4 PE=3 SV=1 15 453 3.0E-141
sp|Q7S3C9|KMO_NEUCR Kynurenine 3-monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nic-3 PE=3 SV=3 15 451 6.0E-133
sp|A1CT23|KMO_ASPCL Kynurenine 3-monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna4 PE=3 SV=1 2 470 1.0E-132
sp|Q0CRI5|KMO_ASPTN Kynurenine 3-monooxygenase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bna4 PE=3 SV=1 2 470 3.0E-131
sp|Q4WN75|KMO_ASPFU Kynurenine 3-monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna4 PE=3 SV=1 2 470 1.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GQG8|KMO_CHAGB Kynurenine 3-monooxygenase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BNA4 PE=3 SV=1 15 453 3.0E-141
sp|Q7S3C9|KMO_NEUCR Kynurenine 3-monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nic-3 PE=3 SV=3 15 451 6.0E-133
sp|A1CT23|KMO_ASPCL Kynurenine 3-monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bna4 PE=3 SV=1 2 470 1.0E-132
sp|Q0CRI5|KMO_ASPTN Kynurenine 3-monooxygenase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bna4 PE=3 SV=1 2 470 3.0E-131
sp|Q4WN75|KMO_ASPFU Kynurenine 3-monooxygenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bna4 PE=3 SV=1 2 470 1.0E-130
sp|B0Y7C3|KMO_ASPFC Kynurenine 3-monooxygenase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bna4 PE=3 SV=1 2 470 1.0E-130
sp|Q2UPP1|KMO_ASPOR Kynurenine 3-monooxygenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bna4 PE=3 SV=1 2 450 5.0E-129
sp|Q5B2N0|KMO_EMENI Kynurenine 3-monooxygenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bna4 PE=3 SV=2 2 470 5.0E-128
sp|A2QPD9|KMO3_ASPNC Kynurenine 3-monooxygenase 3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bna4-3 PE=3 SV=1 2 465 4.0E-127
sp|A1DMD5|KMO_NEOFI Kynurenine 3-monooxygenase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bna4 PE=3 SV=1 2 470 1.0E-126
sp|Q0V5K1|KMO_PHANO Kynurenine 3-monooxygenase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BNA4 PE=3 SV=3 2 446 1.0E-115
sp|A2QMH1|KMO2_ASPNC Kynurenine 3-monooxygenase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bna4-2 PE=3 SV=2 3 466 5.0E-109
sp|A2Q9N7|KMO1_ASPNC Kynurenine 3-monooxygenase 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bna4-1 PE=3 SV=1 15 446 4.0E-74
sp|Q6C9M8|KMO_YARLI Kynurenine 3-monooxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BNA4 PE=3 SV=1 1 466 3.0E-71
sp|P0CO49|KMO_CRYNB Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BNA4 PE=3 SV=1 3 471 1.0E-67
sp|P0CO48|KMO_CRYNJ Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BNA4 PE=3 SV=1 3 471 3.0E-67
sp|B4MPK3|KTU_DROWI Protein kintoun OS=Drosophila willistoni GN=Ppi20 PE=3 SV=1 9 465 1.0E-61
sp|Q5A7M3|KMO_CANAL Kynurenine 3-monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA4 PE=3 SV=1 2 446 1.0E-61
sp|A1Z746|KMO_DROME Kynurenine 3-monooxygenase OS=Drosophila melanogaster GN=cn PE=2 SV=2 4 463 3.0E-59
sp|Q751I2|KMO_ASHGO Kynurenine 3-monooxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA4 PE=3 SV=1 2 446 1.0E-58
sp|P38169|KMO_YEAST Kynurenine 3-monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA4 PE=1 SV=1 2 446 2.0E-58
sp|Q21795|KMO_CAEEL Kynurenine 3-monooxygenase OS=Caenorhabditis elegans GN=kmo-1 PE=3 SV=1 1 446 1.0E-57
sp|Q7Q6A7|KMO_ANOGA Kynurenine 3-monooxygenase OS=Anopheles gambiae GN=kh PE=3 SV=2 4 468 1.0E-57
sp|A3LNF8|KMO_PICST Kynurenine 3-monooxygenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA4 PE=3 SV=2 2 446 8.0E-57
sp|Q9MZS9|KMO_PIG Kynurenine 3-monooxygenase OS=Sus scrofa GN=KMO PE=2 SV=2 4 455 2.0E-56
sp|O15229|KMO_HUMAN Kynurenine 3-monooxygenase OS=Homo sapiens GN=KMO PE=1 SV=2 2 462 3.0E-55
sp|A8Y432|KMO_CAEBR Kynurenine 3-monooxygenase OS=Caenorhabditis briggsae GN=kmo-1 PE=3 SV=1 1 446 5.0E-55
sp|Q91WN4|KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus GN=Kmo PE=1 SV=1 2 416 5.0E-55
sp|Q1RLY6|KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio GN=kmo PE=2 SV=1 4 464 5.0E-55
sp|Q86PM2|KMO_AEDAE Kynurenine 3-monooxygenase OS=Aedes aegypti GN=kh PE=1 SV=2 15 467 6.0E-55
sp|Q6BV21|KMO_DEBHA Kynurenine 3-monooxygenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BNA4 PE=3 SV=2 2 453 2.0E-53
sp|O88867|KMO_RAT Kynurenine 3-monooxygenase OS=Rattus norvegicus GN=Kmo PE=1 SV=1 15 416 2.0E-50
sp|A6H1P4|KMO_FLAPJ Kynurenine 3-monooxygenase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=kmo PE=3 SV=1 2 436 9.0E-47
sp|Q6DIZ8|KMO_XENTR Kynurenine 3-monooxygenase OS=Xenopus tropicalis GN=kmo PE=2 SV=1 17 467 6.0E-45
sp|A0M4X2|KMO_GRAFK Kynurenine 3-monooxygenase OS=Gramella forsetii (strain KT0803) GN=kmo PE=3 SV=2 4 446 3.0E-44
sp|A5FMP6|KMO_FLAJ1 Kynurenine 3-monooxygenase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=kmo PE=3 SV=1 3 436 1.0E-43
sp|Q1DDU6|KMO_MYXXD Kynurenine 3-monooxygenase OS=Myxococcus xanthus (strain DK 1622) GN=kmo PE=3 SV=1 2 429 3.0E-40
sp|A5IG23|KMO_LEGPC Kynurenine 3-monooxygenase OS=Legionella pneumophila (strain Corby) GN=kmo PE=3 SV=1 1 446 4.0E-37
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 8 446 4.0E-37
sp|Q5WY16|KMO_LEGPL Kynurenine 3-monooxygenase OS=Legionella pneumophila (strain Lens) GN=kmo PE=3 SV=1 1 446 2.0E-36
sp|Q11PP7|KMO_CYTH3 Kynurenine 3-monooxygenase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=kmo PE=1 SV=1 2 439 6.0E-36
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 3 446 7.0E-36
sp|A4XD40|KMO_SALTO Kynurenine 3-monooxygenase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=kmo PE=3 SV=1 8 336 3.0E-34
sp|B2FL98|KMO_STRMK Kynurenine 3-monooxygenase OS=Stenotrophomonas maltophilia (strain K279a) GN=kmo PE=3 SV=1 6 449 4.0E-34
sp|Q2P316|KMO_XANOM Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=kmo PE=3 SV=1 4 447 1.0E-33
sp|B2SIT6|KMO_XANOP Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=kmo PE=3 SV=2 4 447 4.0E-33
sp|Q5H038|KMO_XANOR Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=kmo PE=3 SV=1 4 447 4.0E-33
sp|Q4P0N0|KMO_USTMA Kynurenine 3-monooxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BNA4 PE=3 SV=2 30 442 9.0E-33
sp|Q8PAD3|KMO_XANCP Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kmo PE=3 SV=1 4 447 2.0E-32
sp|Q4UT92|KMO_XANC8 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=kmo PE=3 SV=1 4 447 2.0E-32
sp|B0RV00|KMO_XANCB Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=kmo PE=3 SV=1 4 447 1.0E-31
sp|Q8PM34|KMO_XANAC Kynurenine 3-monooxygenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kmo PE=3 SV=1 4 336 7.0E-31
sp|Q3BV41|KMO_XANC5 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=kmo PE=3 SV=1 4 336 7.0E-30
sp|Q54RE8|KMO_DICDI Kynurenine 3-monooxygenase OS=Dictyostelium discoideum GN=kmo PE=3 SV=1 22 428 3.0E-29
sp|Q4P0N0|KMO_USTMA Kynurenine 3-monooxygenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BNA4 PE=3 SV=2 2 170 1.0E-21
sp|Q9S3U9|VIOC_CHRVO Probable monooxygenase VioC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=vioC PE=1 SV=2 1 394 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 445 467 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5720
MEKVVIVGAGPVGCLAAYYAARRGCQVDVYELRSDLRSRQSAPPASTQSINLTLSERGINAIKLAGHATLLSEIM
DDTVPIIGRMVHGRNSDGSLYEHAQKYDVKGRATHAVDRFSLNSHLLDAINSMPNVKLFFNHRLTSSNLHTHYAY
FEVRDATSKLGHCHQAIEVTFDLLIGADGSHSVVRQHLMKVCPIDYHQEYLDMVWFAFHLTPHLVDRQDGRWAQY
RISQNHLHIWPSKDLMFIAIANKDGSFTCTLFLSRQQSADLESNPSDLPAFFDKHFPGVTDLISGEKIISSFIKN
SRLPIFSQKCRPAIYGQGVNAGMEDVRILYSILDKHAHTGHDAFTETQPEPPRSRFMLPFQRARALAEYSAMREA
DAHAIHSLALENYAELRSSLSKRYRVRKFVEECITDYFPSSGWRTKFAGVCFSNDGHSAVLDQNQRQGRLLITGF
LVFFTYFFAVAAGVIGYCNWL
Coding >Ophio5|5720
ATGGAGAAAGTCGTGATAGTCGGGGCTGGGCCTGTAGGCTGTTTGGCGGCTTACTATGCTGCTCGAAGGGGCTGC
CAAGTTGATGTGTACGAGCTGCGCTCGGATCTCCGTAGTCGGCAGTCTGCCCCGCCTGCCTCGACTCAGTCTATC
AACTTGACCTTGTCGGAGCGCGGTATCAACGCTATTAAGCTGGCCGGCCATGCCACATTACTCAGTGAGATCATG
GACGACACCGTTCCTATCATCGGTCGAATGGTTCACGGCAGGAATTCCGATGGTTCATTGTATGAACACGCTCAG
AAATACGACGTCAAGGGCCGAGCCACCCACGCGGTTGACCGGTTTAGTCTCAACTCACACCTCCTAGACGCTATC
AACTCCATGCCTAATGTGAAGCTTTTCTTCAACCACAGGCTTACCAGTTCCAATTTACACACTCATTACGCCTAT
TTTGAGGTCCGAGATGCCACCTCAAAGTTGGGACACTGCCATCAAGCGATTGAGGTTACCTTTGATCTGCTGATT
GGTGCCGATGGTTCCCATTCAGTCGTGCGCCAACACCTCATGAAGGTTTGCCCTATAGATTACCATCAGGAGTAT
CTTGACATGGTGTGGTTTGCCTTCCACCTGACCCCCCATCTAGTCGACCGACAGGATGGCCGATGGGCCCAATAC
CGGATTTCACAGAACCACTTGCACATATGGCCGAGCAAGGACCTCATGTTTATTGCCATAGCAAACAAGGACGGA
TCGTTCACTTGCACCTTGTTCCTTTCAAGACAGCAGAGCGCCGATCTTGAGAGCAACCCGTCCGACTTGCCAGCC
TTCTTCGACAAGCACTTCCCTGGCGTTACGGACTTGATTTCCGGAGAAAAGATAATCTCATCTTTCATCAAAAAT
TCCCGTCTACCCATCTTCAGCCAGAAGTGCCGACCTGCCATTTATGGCCAAGGAGTAAACGCCGGCATGGAAGAT
GTGCGAATCCTCTATTCTATCCTCGATAAGCACGCCCACACCGGCCACGATGCCTTCACCGAGACACAGCCTGAA
CCCCCCCGCTCTCGCTTTATGTTGCCATTCCAACGGGCCCGGGCACTAGCCGAATACTCGGCCATGCGAGAAGCC
GATGCCCACGCCATCCACAGCTTGGCCCTAGAGAACTACGCTGAGCTGCGGTCGTCACTGTCGAAGAGATACAGG
GTGCGCAAGTTCGTTGAGGAGTGTATAACTGATTATTTCCCTAGCAGTGGCTGGCGAACCAAGTTTGCAGGCGTT
TGTTTCAGCAACGATGGTCATTCCGCCGTTTTGGATCAGAACCAACGCCAGGGCCGGCTTCTGATAACTGGTTTT
CTGGTCTTCTTCACTTATTTCTTCGCAGTCGCGGCGGGGGTTATTGGGTACTGCAACTGGCTG
Transcript >Ophio5|5720
ATGGAGAAAGTCGTGATAGTCGGGGCTGGGCCTGTAGGCTGTTTGGCGGCTTACTATGCTGCTCGAAGGGGCTGC
CAAGTTGATGTGTACGAGCTGCGCTCGGATCTCCGTAGTCGGCAGTCTGCCCCGCCTGCCTCGACTCAGTCTATC
AACTTGACCTTGTCGGAGCGCGGTATCAACGCTATTAAGCTGGCCGGCCATGCCACATTACTCAGTGAGATCATG
GACGACACCGTTCCTATCATCGGTCGAATGGTTCACGGCAGGAATTCCGATGGTTCATTGTATGAACACGCTCAG
AAATACGACGTCAAGGGCCGAGCCACCCACGCGGTTGACCGGTTTAGTCTCAACTCACACCTCCTAGACGCTATC
AACTCCATGCCTAATGTGAAGCTTTTCTTCAACCACAGGCTTACCAGTTCCAATTTACACACTCATTACGCCTAT
TTTGAGGTCCGAGATGCCACCTCAAAGTTGGGACACTGCCATCAAGCGATTGAGGTTACCTTTGATCTGCTGATT
GGTGCCGATGGTTCCCATTCAGTCGTGCGCCAACACCTCATGAAGGTTTGCCCTATAGATTACCATCAGGAGTAT
CTTGACATGGTGTGGTTTGCCTTCCACCTGACCCCCCATCTAGTCGACCGACAGGATGGCCGATGGGCCCAATAC
CGGATTTCACAGAACCACTTGCACATATGGCCGAGCAAGGACCTCATGTTTATTGCCATAGCAAACAAGGACGGA
TCGTTCACTTGCACCTTGTTCCTTTCAAGACAGCAGAGCGCCGATCTTGAGAGCAACCCGTCCGACTTGCCAGCC
TTCTTCGACAAGCACTTCCCTGGCGTTACGGACTTGATTTCCGGAGAAAAGATAATCTCATCTTTCATCAAAAAT
TCCCGTCTACCCATCTTCAGCCAGAAGTGCCGACCTGCCATTTATGGCCAAGGAGTAAACGCCGGCATGGAAGAT
GTGCGAATCCTCTATTCTATCCTCGATAAGCACGCCCACACCGGCCACGATGCCTTCACCGAGACACAGCCTGAA
CCCCCCCGCTCTCGCTTTATGTTGCCATTCCAACGGGCCCGGGCACTAGCCGAATACTCGGCCATGCGAGAAGCC
GATGCCCACGCCATCCACAGCTTGGCCCTAGAGAACTACGCTGAGCTGCGGTCGTCACTGTCGAAGAGATACAGG
GTGCGCAAGTTCGTTGAGGAGTGTATAACTGATTATTTCCCTAGCAGTGGCTGGCGAACCAAGTTTGCAGGCGTT
TGTTTCAGCAACGATGGTCATTCCGCCGTTTTGGATCAGAACCAACGCCAGGGCCGGCTTCTGATAACTGGTTTT
CTGGTCTTCTTCACTTATTTCTTCGCAGTCGCGGCGGGGGTTATTGGGTACTGCAACTGGCTGTAG
Gene >Ophio5|5720
ATGGAGAAAGTCGTGATAGTCGGGGCTGGGCCTGTAGGCTGTTTGGCGGCTTACTATGCTGCTCGAAGGGGCTGC
CAAGTTGATGTGTACGAGCTGCGCTCGGGTAGGTGTATTGCGGAATGCCAGTTCGTCTCTCCATCAGCCAGCTCA
CCATACTCTCTCTAGATCTCCGTAGTCGGCAGTCTGCCCCGCCTGCCTCGACTCAGTCTATCAACTTGACCTTGT
CGGAGCGCGGTATCAACGCTATTAAGCTGGCCGGCCATGCCACATTACTCAGTGAGATCATGGACGACACCGTTC
CTATCATCGGTCGAATGGTTCACGGCAGGAATTCCGATGGTTCATTGTATGAACACGCTCAGAAATACGACGTCA
AGGGCCGAGCCACCCACGCGGTTGACCGGTTTAGTCTCAACTCACACCTCCTAGACGCTATCAACTCCATGCCTA
ATGTGAAGCTTTTCTTCAACCACAGGCTTACCAGTTCCAATTTACACACTCATTACGCCTATTTTGAGGTCCGAG
ATGCCACCTCAAAGTTGGGACACTGCCATCAAGCGATTGAGGTTACCTTTGATCTGCTGATTGGTGCCGATGGTT
CCCATTCAGTCGTGCGCCAACACCTCATGAAGGTTTGCCCTATAGATTACCATCAGGAGTATCTTGACATGGTGT
GGTTTGCCTTCCACCTGACCCCCCATCTAGTCGACCGACAGGATGGCCGATGGGCCCAATACCGGATTTCACAGA
ACCACTTGCACATATGGCCGAGCAAGGACCTCATGTTTATTGCCATAGCAAACAAGGTCTATTCATCCATACCCA
AGTCCTCTTCCGCTACCTAAGGCTTATACAGTTCTGACTCTCAACATTAGGACGGATCGTTCACTTGCACCTTGT
TCCTTTCAAGACAGCAGAGCGCCGATCTTGAGAGCAACCCGTCCGACTTGCCAGCCTTCTTCGACAAGCACTTCC
CTGGCGTTACGGACTTGATTTCCGGAGAAAAGATAATCTCATCTTTCATCAAAAATTCCCGTCTACCCATCTTCA
GCCAGAAGTGCCGACCGTATAGTTCTGGCTCGTCATGCGTTATAGTCGGCGACGCTGCGCACACCATAGTGCCAT
TTATGGCCAAGGAGTAAACGCCGGCATGGAAGATGTGCGAATCCTCTATTCTATCCTCGATAAGCACGCCCACAC
CGGCCACGATGCCTTCACCGAGACACAGCCTGAACCCCCCCGCTCTCGCTTTATGTTGCCATTCCAACGGGCCCG
GGCACTAGCCGAATACTCGGCCATGCGAGAAGCCGATGCCCACGCCATCCACAGCTTGGCCCTAGAGAACTACGC
TGAGCTGCGGTCGTCACTGTCGAAGAGATACAGGGTGCGCAAGTTCGTTGAGGAGTGTATAACTGATTATTTCCC
TAGCAGTGGCTGGCGAACCAAGTTTGCAGGCGTTTGTTTCAGCAACGATGGTCATTCCGCCGTTTTGGATCAGAA
CCAACGCCAGGGCCGGCTTCTGATAACTGGTTTTCTGGTCTTCTTCACTTATTTCTTCGCAGTCGCGGCGGGGGT
TATTGGGTACTGCAACTGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail