Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5719
Gene name
Locationscaffold_478:2888..4034
Strand-
Gene length (bp)1146
Transcript length (bp)1146
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 4.7E-05 83 130
PF01476 LysM LysM domain 1.7E-04 214 256

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 4.39 1.09 7.69
CcL In ants, during behavior modification 1.77 0.16 3.38
CcD In ants, recently dead 1.74 0.02 3.46

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.029965 yes
SC16a CcD 0.038524 yes
CcL CcD 0.981573 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5719
MASMKHCIFLVGSAQLLLGALVNAHLVPRATRSLADANVAAPVETTNFAAGPGASQEGKSGPSLGGEGESGASRG
GNQKLCPYQVKLEEHCWGIKTDFNITLDQFYEFNPEVNGDAKNCDLAVGQTLQLPCIDASPARQPVVSQDAPCTD
TFKTEEAGTCRSIVLNKFISFRNLKDWNPQLQANEAGECDIPAGTEVCISKSEKKITCTKEYSAKSDDVCHEIAA
AQGITVNLLSGMNPNIIDNYCLIHPNQKLCVAAEGFSTEKTAATGNATQPLRAEDGQEAGQGAGDKSGQQETVSI
VKAIEQFVAPFAGNVTDPNANPDPKLLEPIKQKVEQFMKSGSTKSSPDDSGLVKSVELGLKEEGMAGAAGNTKRS
FAWTLF
Coding >Ophio5|5719
ATGGCGTCTATGAAACACTGCATCTTCCTCGTCGGCAGCGCCCAGCTACTGCTCGGAGCCTTGGTCAACGCCCAC
CTCGTCCCTCGGGCCACACGGTCACTCGCAGATGCGAATGTCGCCGCTCCTGTGGAGACGACCAACTTTGCTGCA
GGACCCGGCGCCTCGCAAGAGGGAAAGTCAGGGCCTTCGCTGGGAGGAGAAGGAGAGTCGGGAGCCTCGCGAGGA
GGAAACCAGAAACTCTGCCCTTACCAGGTCAAGTTGGAGGAGCACTGTTGGGGAATCAAGACGGATTTCAACATC
ACACTGGACCAGTTCTACGAATTCAACCCGGAAGTTAACGGGGATGCGAAAAACTGCGACCTAGCAGTTGGACAA
ACACTTCAGCTCCCCTGCATAGACGCGTCGCCGGCGAGGCAGCCTGTCGTAAGCCAAGATGCCCCTTGCACAGAC
ACGTTCAAGACCGAGGAGGCAGGGACCTGCAGGTCCATTGTCCTCAACAAGTTCATCAGTTTCAGGAACCTGAAG
GATTGGAACCCCCAACTCCAGGCCAACGAGGCTGGTGAATGCGATATTCCGGCCGGCACCGAAGTGTGCATCTCC
AAGTCCGAAAAGAAGATCACTTGCACCAAGGAATACTCGGCGAAGTCAGACGACGTATGTCACGAGATCGCCGCG
GCCCAGGGCATCACCGTGAACCTGCTCAGCGGCATGAACCCGAACATCATCGACAACTACTGCCTAATTCATCCG
AACCAGAAGCTCTGCGTCGCCGCCGAAGGCTTCTCGACGGAAAAGACGGCTGCGACCGGCAACGCCACGCAGCCG
CTGCGCGCGGAAGATGGCCAAGAAGCTGGCCAGGGCGCTGGCGACAAGTCGGGCCAGCAGGAGACCGTCAGCATT
GTCAAGGCCATCGAGCAGTTCGTCGCTCCGTTCGCCGGCAACGTGACCGATCCCAACGCAAACCCGGACCCCAAG
CTGTTGGAGCCCATCAAGCAGAAGGTCGAGCAGTTCATGAAGAGCGGCAGCACGAAGTCCAGCCCCGACGATTCG
GGACTTGTCAAGTCTGTCGAATTGGGCTTGAAGGAGGAGGGCATGGCCGGTGCGGCTGGCAACACCAAGAGGTCC
TTTGCCTGGACTCTCTTC
Transcript >Ophio5|5719
ATGGCGTCTATGAAACACTGCATCTTCCTCGTCGGCAGCGCCCAGCTACTGCTCGGAGCCTTGGTCAACGCCCAC
CTCGTCCCTCGGGCCACACGGTCACTCGCAGATGCGAATGTCGCCGCTCCTGTGGAGACGACCAACTTTGCTGCA
GGACCCGGCGCCTCGCAAGAGGGAAAGTCAGGGCCTTCGCTGGGAGGAGAAGGAGAGTCGGGAGCCTCGCGAGGA
GGAAACCAGAAACTCTGCCCTTACCAGGTCAAGTTGGAGGAGCACTGTTGGGGAATCAAGACGGATTTCAACATC
ACACTGGACCAGTTCTACGAATTCAACCCGGAAGTTAACGGGGATGCGAAAAACTGCGACCTAGCAGTTGGACAA
ACACTTCAGCTCCCCTGCATAGACGCGTCGCCGGCGAGGCAGCCTGTCGTAAGCCAAGATGCCCCTTGCACAGAC
ACGTTCAAGACCGAGGAGGCAGGGACCTGCAGGTCCATTGTCCTCAACAAGTTCATCAGTTTCAGGAACCTGAAG
GATTGGAACCCCCAACTCCAGGCCAACGAGGCTGGTGAATGCGATATTCCGGCCGGCACCGAAGTGTGCATCTCC
AAGTCCGAAAAGAAGATCACTTGCACCAAGGAATACTCGGCGAAGTCAGACGACGTATGTCACGAGATCGCCGCG
GCCCAGGGCATCACCGTGAACCTGCTCAGCGGCATGAACCCGAACATCATCGACAACTACTGCCTAATTCATCCG
AACCAGAAGCTCTGCGTCGCCGCCGAAGGCTTCTCGACGGAAAAGACGGCTGCGACCGGCAACGCCACGCAGCCG
CTGCGCGCGGAAGATGGCCAAGAAGCTGGCCAGGGCGCTGGCGACAAGTCGGGCCAGCAGGAGACCGTCAGCATT
GTCAAGGCCATCGAGCAGTTCGTCGCTCCGTTCGCCGGCAACGTGACCGATCCCAACGCAAACCCGGACCCCAAG
CTGTTGGAGCCCATCAAGCAGAAGGTCGAGCAGTTCATGAAGAGCGGCAGCACGAAGTCCAGCCCCGACGATTCG
GGACTTGTCAAGTCTGTCGAATTGGGCTTGAAGGAGGAGGGCATGGCCGGTGCGGCTGGCAACACCAAGAGGTCC
TTTGCCTGGACTCTCTTCTAA
Gene >Ophio5|5719
ATGGCGTCTATGAAACACTGCATCTTCCTCGTCGGCAGCGCCCAGCTACTGCTCGGAGCCTTGGTCAACGCCCAC
CTCGTCCCTCGGGCCACACGGTCACTCGCAGATGCGAATGTCGCCGCTCCTGTGGAGACGACCAACTTTGCTGCA
GGACCCGGCGCCTCGCAAGAGGGAAAGTCAGGGCCTTCGCTGGGAGGAGAAGGAGAGTCGGGAGCCTCGCGAGGA
GGAAACCAGAAACTCTGCCCTTACCAGGTCAAGTTGGAGGAGCACTGTTGGGGAATCAAGACGGATTTCAACATC
ACACTGGACCAGTTCTACGAATTCAACCCGGAAGTTAACGGGGATGCGAAAAACTGCGACCTAGCAGTTGGACAA
ACACTTCAGCTCCCCTGCATAGACGCGTCGCCGGCGAGGCAGCCTGTCGTAAGCCAAGATGCCCCTTGCACAGAC
ACGTTCAAGACCGAGGAGGCAGGGACCTGCAGGTCCATTGTCCTCAACAAGTTCATCAGTTTCAGGAACCTGAAG
GATTGGAACCCCCAACTCCAGGCCAACGAGGCTGGTGAATGCGATATTCCGGCCGGCACCGAAGTGTGCATCTCC
AAGTCCGAAAAGAAGATCACTTGCACCAAGGAATACTCGGCGAAGTCAGACGACGTATGTCACGAGATCGCCGCG
GCCCAGGGCATCACCGTGAACCTGCTCAGCGGCATGAACCCGAACATCATCGACAACTACTGCCTAATTCATCCG
AACCAGAAGCTCTGCGTCGCCGCCGAAGGCTTCTCGACGGAAAAGACGGCTGCGACCGGCAACGCCACGCAGCCG
CTGCGCGCGGAAGATGGCCAAGAAGCTGGCCAGGGCGCTGGCGACAAGTCGGGCCAGCAGGAGACCGTCAGCATT
GTCAAGGCCATCGAGCAGTTCGTCGCTCCGTTCGCCGGCAACGTGACCGATCCCAACGCAAACCCGGACCCCAAG
CTGTTGGAGCCCATCAAGCAGAAGGTCGAGCAGTTCATGAAGAGCGGCAGCACGAAGTCCAGCCCCGACGATTCG
GGACTTGTCAAGTCTGTCGAATTGGGCTTGAAGGAGGAGGGCATGGCCGGTGCGGCTGGCAACACCAAGAGGTCC
TTTGCCTGGACTCTCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail