Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5711
Gene name
Locationscaffold_476:12232..13322
Strand+
Gene length (bp)1090
Transcript length (bp)861
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 116 138 22
3 151 173 22
4 193 215 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 49.93 24.48 75.38
CcL In ants, during behavior modification 57.27 28.81 85.72
CcD In ants, recently dead 26.57 11.12 42.01

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.625390 no
SC16a CcD 0.013983 yes
CcL CcD 0.003389 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5711
MVSTRSTSSRTASDSRLASGDSSPPMTPPIKVAKRSKRSSRRVASAAGWTHTPSRATLFWMAVSLPLVAWDTVYV
LGRPHTMEGGALHWPLWVPYKLYGEVDHIYGWKAFNARNGFTAAQGLLNLVETAMYLFYLGIFVGSPSRRLTGRP
AAVAVLVGFSAAVMTLSKTLLYWMNEYYSGFDNIGHNPLLDLVYLWIIPNGAWLVGSSYMIWNLGSDILDGLETA
AQMGKRRVGKLHAIGLTPFVRECEAKDKREIVSSSRASWSSPNGRWGYQMIRKDKNEKEKT
Coding >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGGATGAAC
GAATACTACAGCGGCTTCGACAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAC
GGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAATCTCGGCAGCGACATCCTCGACGGACTCGAGACTGCC
GCGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGACGCCCTTTGTGAGGGAATGTGAAGCC
AAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCAGATG
ATCAGGAAAGACAAGAATGAAAAAGAAAAGACG
Transcript >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGGATGAAC
GAATACTACAGCGGCTTCGACAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAC
GGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAATCTCGGCAGCGACATCCTCGACGGACTCGAGACTGCC
GCGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGACGCCCTTTGTGAGGGAATGTGAAGCC
AAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCAGATG
ATCAGGAAAGACAAGAATGAAAAAGAAAAGACGTGA
Gene >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGTAAGTGA
GCCCTACCCTTTGCTCTCCCTGTCTTGCGCTGACGCCCCACATCCAGGGATGAACGAATACTACAGCGGCTTCGA
CAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAGTCCGTTGTCCATCCCCTCCA
CTCCTCCCCCATACAGCGCTGACCTCGGCCTACAGCGGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAAT
CTCGGCAGCGACATCCTCGACGGACTCGAGACTGCCGCGTCCCACGCCAAACAAGAATAGGATATCATTCACGGC
AAGCATTCATGTCGAGCCGGCCTAGTAGGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGA
CGCCCTTTGTGAGGGAATGTGAAGCCAAGGCAAGCCACGCCTCCCAAACGAGACGCCGATCCAGAAGATTGAGAT
GAAGTAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCA
GATGATCAGGAAAGACAAGAATGAAAAAGAAAAGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail