Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5711
Gene name
Locationscaffold_476:12232..13322
Strand+
Gene length (bp)1090
Transcript length (bp)861
Coding sequence length (bp)858
Protein length (aa) 286

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.1291 0.4257 0.0873 0.0705 0.1107 0.0604 0.2916 0.1057 0.2209 0.0457

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 116 138 22
3 151 173 22
4 193 215 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4407
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1538
Ophiocordyceps australis map64 (Brazil) OphauB2|4016
Ophiocordyceps camponoti-floridani Ophcf2|06988
Ophiocordyceps camponoti-rufipedis Ophun1|7266
Ophiocordyceps kimflemingae Ophio5|5711 (this protein)
Ophiocordyceps subramaniannii Hirsu2|912

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5711
MVSTRSTSSRTASDSRLASGDSSPPMTPPIKVAKRSKRSSRRVASAAGWTHTPSRATLFWMAVSLPLVAWDTVYV
LGRPHTMEGGALHWPLWVPYKLYGEVDHIYGWKAFNARNGFTAAQGLLNLVETAMYLFYLGIFVGSPSRRLTGRP
AAVAVLVGFSAAVMTLSKTLLYWMNEYYSGFDNIGHNPLLDLVYLWIIPNGAWLVGSSYMIWNLGSDILDGLETA
AQMGKRRVGKLHAIGLTPFVRECEAKDKREIVSSSRASWSSPNGRWGYQMIRKDKNEKEKT
Coding >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGGATGAAC
GAATACTACAGCGGCTTCGACAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAC
GGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAATCTCGGCAGCGACATCCTCGACGGACTCGAGACTGCC
GCGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGACGCCCTTTGTGAGGGAATGTGAAGCC
AAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCAGATG
ATCAGGAAAGACAAGAATGAAAAAGAAAAGACG
Transcript >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGGATGAAC
GAATACTACAGCGGCTTCGACAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAC
GGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAATCTCGGCAGCGACATCCTCGACGGACTCGAGACTGCC
GCGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGACGCCCTTTGTGAGGGAATGTGAAGCC
AAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCAGATG
ATCAGGAAAGACAAGAATGAAAAAGAAAAGACGTGA
Gene >Ophio5|5711
ATGGTTAGCACGCGCTCCACCTCGTCGCGCACCGCCAGCGACAGTCGTCTCGCGTCCGGCGACTCCTCACCTCCT
ATGACGCCTCCCATCAAAGTGGCTAAGCGCTCCAAGCGGAGCAGCAGAAGAGTGGCGAGCGCCGCCGGCTGGACG
CACACTCCTTCGCGCGCCACGCTCTTCTGGATGGCTGTTTCGCTACCCCTCGTCGCGTGGGATACCGTCTATGTG
CTCGGTCGGCCTCATACAATGGAGGGCGGCGCGCTGCATTGGCCGTTGTGGGTGCCGTACAAGCTCTATGGCGAG
GTGGATCATATCTACGGCTGGAAGGCATTCAATGCCCGCAATGGCTTTACCGCTGCCCAGGGGTTACTCAACCTC
GTTGAGACGGCCATGTATTTGTTCTACTTGGGAATCTTCGTTGGCTCGCCGTCGCGACGATTGACGGGGAGGCCT
GCTGCTGTTGCTGTCCTCGTCGGCTTCAGCGCTGCTGTCATGACACTGAGCAAGACATTACTCTACTGTAAGTGA
GCCCTACCCTTTGCTCTCCCTGTCTTGCGCTGACGCCCCACATCCAGGGATGAACGAATACTACAGCGGCTTCGA
CAACATCGGCCACAACCCTCTACTCGACCTCGTCTACCTCTGGATCATCCCCAAGTCCGTTGTCCATCCCCTCCA
CTCCTCCCCCATACAGCGCTGACCTCGGCCTACAGCGGTGCCTGGCTCGTCGGCTCGTCGTACATGATCTGGAAT
CTCGGCAGCGACATCCTCGACGGACTCGAGACTGCCGCGTCCCACGCCAAACAAGAATAGGATATCATTCACGGC
AAGCATTCATGTCGAGCCGGCCTAGTAGGCAGATGGGGAAAAGAAGGGTGGGGAAATTGCACGCCATCGGTTTGA
CGCCCTTTGTGAGGGAATGTGAAGCCAAGGCAAGCCACGCCTCCCAAACGAGACGCCGATCCAGAAGATTGAGAT
GAAGTAGGATAAAAGGGAAATAGTCTCGTCATCTCGAGCTAGTTGGTCCAGTCCCAACGGACGATGGGGGTATCA
GATGATCAGGAAAGACAAGAATGAAAAAGAAAAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail