Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5709
Gene name
Locationscaffold_476:3532..8793
Strand+
Gene length (bp)5261
Transcript length (bp)4980
Coding sequence length (bp)4977
Protein length (aa) 1659

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2056 0.1013 0.9072 0.2112 0.0535 0.0255 0.2401 0.2375 0.2796 0.0019

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999793

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.11 0.75 3.46
CcL In ants, during behavior modification 5.64 1.52 9.77
CcD In ants, recently dead 3.71 1.42 6.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.003573 yes
SC16a CcD 0.066632 no
CcL CcD 0.237967 no

Orthologs

Orthofinder run ID4
Orthogroup6910
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06985
Ophiocordyceps camponoti-floridani Ophcf2|06986
Ophiocordyceps camponoti-rufipedis Ophun1|7264
Ophiocordyceps kimflemingae Ophio5|5709 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5709
MFYPLLLAALTVLQCVVHGIPITEDEELFCEPGLSEVVPEAGVQPDDPRLETTSVGLTGPQVSLLVTKGAKGAGL
DSNVAEKLALMASRAATSEGIRSANEFVRVVGAVSVSAAVAAPRNASSAVCAMGAIEGLVLVNMGDSPASRCLIT
AAVVAASSGEDREAVTKITENTARAVIRNESSIDASAVTTEASLGCQTEMCQVGIKAAIQLISSGFSVKTALTLC
VAVNTAAKYGIKLEIYAEMLVQQIRLLGQGVEPTRAALKVVEATQRLKQMAQAATDVKNVTLEAAKEMESLPSPD
LSELAHVSADSPKAQMSHQISMNISASSTNQDLTAIETRKTTSIEEVSRDIGQPSLSKTHAVIQATQSSFSSQIM
ESSSAAPMAKVTTAAQKAQMSHQISMNISASSTDQDLAAIETRKTTSIEEVSRDIGQPSPSKTHAVIQATQSLFS
SPMMESSSAAPMAKVTTAALKAQISHQISMNISASSTNQDFTAVETRKTTSTDVSRYIGQPLLSKTHAVIQATRS
LFSSQTMESSSAVPMTKVTTAAQIVKVSSSILTSTSSLTSRIPNQSSHRIVESSLTSAMLGDKDATQVARVAQIA
KASSSISTFISSLTSRIPNQSSHRIVESSLTSSSMLRDTDAAQVARVAQTVKASPSISTSISSLTSRIPNQSSHR
IVESSLTSSSMLRDTDAAQVARVAQTVKASSSISTSTSSLTSRIPNQSSHRIVESSLTSSSSMLLRDTDAAQVAR
VAASPALATGFSTSVQAIEHSATTMMANILPPVQVAVVSSTSLPTELSKTTDGPLAPITQSTPSTLALAVAVTSF
SPTMKSSTSFSPENTSTVNQQPPANVADSQENQAQSAESKAGTIKHESSSETVEKPATSDAETAAVTLQPAPSRP
WRDPDTLSPECIDSLEEECVGTEVWCDRDYYQSSDEFYAYADAAACKQSRTKRPTTAPGPADMHPEEPNITTDIS
KPESKTNDPTPAMTQAQDSELATATGDSSSSEAQKPEWKEPNTDCTGNTAAALESCYGTQIWCRLKAYQQTMETF
DNVVACMQSRKNHPAYIDDLLVWKEPGQDFPGCFAESANDPQRLEACVGTEAFCERKYYENFDEVFDNAEACRKS
RKRRPGLAEGQNKPASVETQNPSTEEHESHSEEDVSSPDNDEEQIPSSNKSTVSDQEKAEDSFTDEKETPSEQQV
PSSKDNRGSSVDGQDPPTEKQDPLADDSNEASMEGHDRPVDENKETTGEEQSHSPNEKGKPFTEGPGNPVDENKE
ASTGEQSNPSDESKGASTKGQGHPADTDGETSTKSQDPPAEKQDPLVNNDNEASEEKGNPVDDNKEVSSAEEQSH
PPNEDKDASKEEQGHPSDDQEESSAERKDPTADGDDDSETEEQGPQVDRKKWRLPRLDSPSCSGLLGHALRFDEK
CVGTELWCDQAFYNLTSDKFADAKECKKSRGLKMPSYVGAWKEAKNSPEDCFFGAEMFTEDCVGTEIWCSRDSYT
PESLQENYTSPEECKELRYNRPIDEEVIATLATNMSSIVDGTHSDIIPSNATYVCWIQGKAGDSLFCDWQLPSDC
EYGAGCSRVEDLPDFCDNNKGCGSCFIGKTTKNFVCYMPQANELTEMGRGVCRQTCLISAENALNGTVQDYHEAL
VEKACELYC
Coding >Ophio5|5709
ATGTTCTACCCTCTCCTCCTCGCCGCTCTGACGGTGCTGCAGTGTGTGGTTCATGGTATTCCAATAACAGAAGAT
GAGGAACTCTTCTGCGAGCCCGGCCTATCTGAAGTCGTTCCTGAAGCTGGCGTGCAACCGGATGATCCCAGGCTC
GAGACCACGAGCGTTGGACTGACAGGCCCTCAAGTTTCACTTCTCGTCACCAAGGGCGCCAAGGGAGCTGGTCTC
GACTCGAATGTTGCGGAAAAACTGGCGCTGATGGCCTCGAGGGCCGCGACGAGCGAGGGCATCAGGTCCGCTAAT
GAGTTCGTCAGAGTCGTCGGCGCCGTCAGCGTCTCGGCCGCCGTTGCCGCCCCCCGTAACGCGTCTTCTGCCGTC
TGCGCTATGGGTGCGATCGAAGGTCTCGTCCTCGTCAACATGGGAGACTCGCCGGCATCCCGCTGCCTTATTACC
GCTGCCGTTGTTGCCGCATCGTCGGGCGAAGACCGGGAAGCCGTCACGAAGATCACCGAAAACACTGCCAGAGCG
GTGATTCGAAACGAAAGCTCCATCGATGCAAGTGCCGTCACGACTGAGGCTTCGCTGGGTTGCCAAACAGAAATG
TGCCAGGTCGGTATCAAGGCGGCCATCCAGCTCATTAGCAGCGGGTTCAGCGTCAAGACAGCTTTGACGCTCTGC
GTGGCCGTCAATACCGCTGCCAAGTACGGTATTAAGCTTGAAATATATGCCGAGATGCTTGTCCAGCAAATTCGG
CTGCTCGGCCAGGGAGTCGAGCCTACTAGGGCAGCTCTCAAGGTTGTGGAAGCTACGCAGAGGCTCAAACAGATG
GCTCAAGCTGCGACAGACGTCAAAAACGTGACACTCGAGGCCGCCAAAGAGATGGAGAGCCTGCCGTCGCCGGAT
CTGTCTGAATTGGCTCATGTGTCGGCCGACAGTCCCAAGGCTCAGATGAGCCATCAGATTAGCATGAACATCTCC
GCTTCTTCGACGAACCAAGACTTAACCGCTATTGAAACGAGAAAGACGACTTCTATTGAGGAGGTGAGCCGCGAT
ATTGGCCAACCTTCGCTAAGCAAGACCCATGCCGTTATTCAAGCAACCCAAAGCTCATTCTCCTCTCAAATAATG
GAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCAAAAGGCTCAGATGAGCCATCAGATTAGC
ATGAATATCTCCGCTTCTTCGACGGACCAAGACTTAGCCGCTATCGAAACGAGAAAGACGACTTCTATTGAGGAG
GTGAGCCGCGATATTGGCCAACCTTCGCCGAGCAAGACCCATGCCGTCATTCAAGCAACTCAAAGCTTATTTTCC
TCTCCAATGATGGAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCTAAAGGCTCAGATAAGC
CATCAGATCAGCATGAATATTTCCGCTTCTTCGACGAACCAAGACTTTACCGCTGTTGAAACGAGAAAGACAACT
TCTACTGACGTGAGCCGCTATATTGGCCAACCTTTGCTAAGCAAGACCCATGCCGTCATTCAAGCAACTCGAAGC
TTATTCTCCTCTCAAACGATGGAATCTTCTTCGGCCGTCCCGATGACCAAAGTCACGACTGCCGCCCAAATAGTC
AAGGTCTCTTCCTCTATTTTGACTTCTACAAGTTCTCTCACAAGTCGAATACCGAACCAGTCTTCACACCGTATT
GTTGAGAGCTCCCTGACTTCTGCAATGTTGGGGGACAAGGATGCTACGCAAGTAGCCAGAGTCGCCCAAATAGCC
AAGGCCTCTTCCTCTATTTCGACGTTTATAAGTTCTCTCACAAGTCGAATACCGAACCAATCTTCACACCGTATA
GTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAAACA
GTCAAGGCCTCTCCCTCTATTTCGACGTCTATAAGTTCTCTCACAAGTCGAATACCGAATCAGTCTTCACACCGT
ATAGTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAA
ACAGTCAAGGCCTCTTCCTCTATTTCGACGTCTACAAGTTCTCTCACAAGTCGAATACCCAATCAGTCTTCACAC
CGTATAGTTGAGAGCTCCCTGACTTCTTCTTCTTCTATGTTGTTGAGGGACACAGATGCTGCGCAAGTAGCCAGA
GTCGCGGCCTCACCTGCTCTTGCCACTGGGTTTTCCACTTCGGTTCAAGCTATCGAGCATTCGGCGACTACTATG
ATGGCCAACATCTTACCCCCTGTCCAAGTGGCCGTTGTCTCTTCCACGTCTCTACCGACGGAGCTTTCCAAGACA
ACTGATGGGCCGCTTGCTCCCATCACGCAAAGTACACCCTCTACCCTAGCACTAGCAGTCGCCGTCACTTCCTTT
TCTCCGACAATGAAGTCGTCCACCTCCTTTTCGCCCGAGAATACTTCCACGGTCAACCAGCAACCGCCAGCGAAC
GTTGCCGACTCTCAAGAAAACCAAGCTCAGAGCGCGGAATCAAAGGCTGGGACGATCAAGCACGAGAGCTCATCC
GAGACTGTCGAGAAGCCTGCAACTTCAGATGCCGAGACCGCAGCTGTCACTCTGCAGCCAGCGCCATCAAGGCCG
TGGCGAGACCCCGATACACTCTCGCCGGAGTGTATTGACTCGCTTGAGGAGGAATGTGTAGGCACCGAGGTCTGG
TGTGACCGAGATTATTACCAAAGCTCTGACGAGTTTTATGCGTACGCTGACGCTGCTGCGTGTAAGCAGAGCCGC
ACCAAGAGGCCAACGACCGCCCCTGGGCCCGCGGACATGCACCCTGAAGAGCCGAACATCACGACCGACATCTCG
AAGCCGGAGAGCAAGACAAACGACCCGACTCCAGCAATGACCCAGGCCCAGGACTCAGAGCTGGCCACTGCAACA
GGAGACTCGAGCTCATCCGAAGCACAGAAGCCTGAGTGGAAAGAGCCCAACACAGATTGCACTGGAAACACGGCA
GCAGCTCTGGAGAGCTGCTACGGCACCCAAATTTGGTGCAGACTCAAGGCTTATCAGCAAACGATGGAAACATTT
GACAATGTCGTGGCCTGCATGCAAAGCCGCAAAAACCACCCAGCATACATCGATGACCTTTTGGTTTGGAAAGAG
CCTGGCCAAGATTTCCCCGGCTGCTTTGCTGAGTCGGCCAATGATCCTCAGCGTCTTGAGGCTTGCGTTGGCACG
GAAGCATTCTGCGAACGGAAATACTACGAAAACTTCGATGAGGTCTTTGATAATGCCGAGGCTTGCAGGAAGAGC
CGCAAGAGACGCCCAGGCCTTGCTGAGGGTCAAAACAAACCAGCCAGCGTTGAAACCCAGAACCCATCTACTGAA
GAGCATGAGTCCCACAGCGAGGAGGACGTTTCCTCTCCAGATAATGACGAGGAGCAGATCCCCTCTTCTAATAAA
TCTACTGTTTCTGACCAAGAGAAAGCTGAGGATTCTTTTACGGACGAAAAGGAGACTCCTTCGGAGCAACAGGTT
CCTTCTTCGAAGGACAACAGGGGGTCATCAGTCGACGGGCAGGACCCTCCTACCGAGAAGCAGGACCCTCTGGCG
GATGACAGTAATGAAGCTTCCATGGAAGGGCACGACCGTCCCGTGGACGAAAATAAGGAGACTACAGGCGAAGAG
CAGAGCCATTCCCCGAACGAGAAAGGAAAGCCTTTCACCGAAGGGCCAGGCAATCCCGTGGACGAAAACAAGGAG
GCTTCAACCGGAGAGCAGAGCAATCCCTCGGACGAGAGTAAAGGTGCTTCCACTAAAGGGCAAGGCCATCCTGCG
GATACGGATGGAGAGACTTCTACCAAGAGTCAGGATCCTCCTGCGGAGAAACAGGATCCTCTCGTGAATAATGAC
AACGAGGCTTCGGAAGAGAAAGGTAATCCCGTGGACGATAACAAGGAAGTTTCATCAGCCGAAGAGCAGAGCCAT
CCACCGAACGAAGACAAAGATGCTTCCAAGGAAGAGCAAGGCCATCCCTCAGACGACCAAGAGGAATCCTCTGCC
GAGAGGAAAGATCCTACCGCAGACGGCGACGACGACTCTGAGACCGAAGAGCAAGGCCCTCAGGTGGACAGAAAG
AAATGGAGACTTCCCAGACTGGATTCCCCATCCTGCTCAGGACTACTAGGTCATGCGCTCAGGTTCGACGAAAAA
TGCGTGGGCACAGAGCTCTGGTGTGATCAAGCATTCTACAACCTGACGAGCGACAAGTTCGCCGACGCCAAAGAG
TGCAAGAAAAGTCGAGGGCTTAAGATGCCATCCTACGTGGGCGCGTGGAAAGAAGCCAAGAATTCCCCAGAAGAC
TGCTTCTTCGGTGCCGAAATGTTCACCGAGGATTGCGTCGGCACCGAAATATGGTGCAGCAGAGATTCCTACACC
CCTGAGAGTCTTCAGGAGAATTATACCTCCCCTGAGGAGTGCAAGGAACTCCGCTACAACCGACCTATAGACGAG
GAGGTCATCGCCACGCTGGCAACGAACATGAGCAGTATTGTAGATGGCACTCATAGCGACATCATCCCGAGCAAC
GCAACATATGTCTGTTGGATACAAGGGAAAGCTGGAGACAGTCTATTCTGTGACTGGCAACTACCCAGCGATTGC
GAGTACGGGGCTGGATGCTCTCGTGTGGAAGACTTGCCCGATTTCTGTGACAATAACAAGGGATGTGGTTCTTGC
TTCATCGGCAAAACCACAAAGAACTTTGTCTGTTATATGCCTCAGGCCAACGAACTGACCGAAATGGGACGAGGT
GTCTGTCGACAGACGTGCTTAATATCCGCAGAAAATGCCCTGAACGGTACGGTCCAGGACTACCATGAGGCTCTC
GTGGAGAAAGCCTGTGAACTTTATTGT
Transcript >Ophio5|5709
ATGTTCTACCCTCTCCTCCTCGCCGCTCTGACGGTGCTGCAGTGTGTGGTTCATGGTATTCCAATAACAGAAGAT
GAGGAACTCTTCTGCGAGCCCGGCCTATCTGAAGTCGTTCCTGAAGCTGGCGTGCAACCGGATGATCCCAGGCTC
GAGACCACGAGCGTTGGACTGACAGGCCCTCAAGTTTCACTTCTCGTCACCAAGGGCGCCAAGGGAGCTGGTCTC
GACTCGAATGTTGCGGAAAAACTGGCGCTGATGGCCTCGAGGGCCGCGACGAGCGAGGGCATCAGGTCCGCTAAT
GAGTTCGTCAGAGTCGTCGGCGCCGTCAGCGTCTCGGCCGCCGTTGCCGCCCCCCGTAACGCGTCTTCTGCCGTC
TGCGCTATGGGTGCGATCGAAGGTCTCGTCCTCGTCAACATGGGAGACTCGCCGGCATCCCGCTGCCTTATTACC
GCTGCCGTTGTTGCCGCATCGTCGGGCGAAGACCGGGAAGCCGTCACGAAGATCACCGAAAACACTGCCAGAGCG
GTGATTCGAAACGAAAGCTCCATCGATGCAAGTGCCGTCACGACTGAGGCTTCGCTGGGTTGCCAAACAGAAATG
TGCCAGGTCGGTATCAAGGCGGCCATCCAGCTCATTAGCAGCGGGTTCAGCGTCAAGACAGCTTTGACGCTCTGC
GTGGCCGTCAATACCGCTGCCAAGTACGGTATTAAGCTTGAAATATATGCCGAGATGCTTGTCCAGCAAATTCGG
CTGCTCGGCCAGGGAGTCGAGCCTACTAGGGCAGCTCTCAAGGTTGTGGAAGCTACGCAGAGGCTCAAACAGATG
GCTCAAGCTGCGACAGACGTCAAAAACGTGACACTCGAGGCCGCCAAAGAGATGGAGAGCCTGCCGTCGCCGGAT
CTGTCTGAATTGGCTCATGTGTCGGCCGACAGTCCCAAGGCTCAGATGAGCCATCAGATTAGCATGAACATCTCC
GCTTCTTCGACGAACCAAGACTTAACCGCTATTGAAACGAGAAAGACGACTTCTATTGAGGAGGTGAGCCGCGAT
ATTGGCCAACCTTCGCTAAGCAAGACCCATGCCGTTATTCAAGCAACCCAAAGCTCATTCTCCTCTCAAATAATG
GAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCAAAAGGCTCAGATGAGCCATCAGATTAGC
ATGAATATCTCCGCTTCTTCGACGGACCAAGACTTAGCCGCTATCGAAACGAGAAAGACGACTTCTATTGAGGAG
GTGAGCCGCGATATTGGCCAACCTTCGCCGAGCAAGACCCATGCCGTCATTCAAGCAACTCAAAGCTTATTTTCC
TCTCCAATGATGGAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCTAAAGGCTCAGATAAGC
CATCAGATCAGCATGAATATTTCCGCTTCTTCGACGAACCAAGACTTTACCGCTGTTGAAACGAGAAAGACAACT
TCTACTGACGTGAGCCGCTATATTGGCCAACCTTTGCTAAGCAAGACCCATGCCGTCATTCAAGCAACTCGAAGC
TTATTCTCCTCTCAAACGATGGAATCTTCTTCGGCCGTCCCGATGACCAAAGTCACGACTGCCGCCCAAATAGTC
AAGGTCTCTTCCTCTATTTTGACTTCTACAAGTTCTCTCACAAGTCGAATACCGAACCAGTCTTCACACCGTATT
GTTGAGAGCTCCCTGACTTCTGCAATGTTGGGGGACAAGGATGCTACGCAAGTAGCCAGAGTCGCCCAAATAGCC
AAGGCCTCTTCCTCTATTTCGACGTTTATAAGTTCTCTCACAAGTCGAATACCGAACCAATCTTCACACCGTATA
GTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAAACA
GTCAAGGCCTCTCCCTCTATTTCGACGTCTATAAGTTCTCTCACAAGTCGAATACCGAATCAGTCTTCACACCGT
ATAGTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAA
ACAGTCAAGGCCTCTTCCTCTATTTCGACGTCTACAAGTTCTCTCACAAGTCGAATACCCAATCAGTCTTCACAC
CGTATAGTTGAGAGCTCCCTGACTTCTTCTTCTTCTATGTTGTTGAGGGACACAGATGCTGCGCAAGTAGCCAGA
GTCGCGGCCTCACCTGCTCTTGCCACTGGGTTTTCCACTTCGGTTCAAGCTATCGAGCATTCGGCGACTACTATG
ATGGCCAACATCTTACCCCCTGTCCAAGTGGCCGTTGTCTCTTCCACGTCTCTACCGACGGAGCTTTCCAAGACA
ACTGATGGGCCGCTTGCTCCCATCACGCAAAGTACACCCTCTACCCTAGCACTAGCAGTCGCCGTCACTTCCTTT
TCTCCGACAATGAAGTCGTCCACCTCCTTTTCGCCCGAGAATACTTCCACGGTCAACCAGCAACCGCCAGCGAAC
GTTGCCGACTCTCAAGAAAACCAAGCTCAGAGCGCGGAATCAAAGGCTGGGACGATCAAGCACGAGAGCTCATCC
GAGACTGTCGAGAAGCCTGCAACTTCAGATGCCGAGACCGCAGCTGTCACTCTGCAGCCAGCGCCATCAAGGCCG
TGGCGAGACCCCGATACACTCTCGCCGGAGTGTATTGACTCGCTTGAGGAGGAATGTGTAGGCACCGAGGTCTGG
TGTGACCGAGATTATTACCAAAGCTCTGACGAGTTTTATGCGTACGCTGACGCTGCTGCGTGTAAGCAGAGCCGC
ACCAAGAGGCCAACGACCGCCCCTGGGCCCGCGGACATGCACCCTGAAGAGCCGAACATCACGACCGACATCTCG
AAGCCGGAGAGCAAGACAAACGACCCGACTCCAGCAATGACCCAGGCCCAGGACTCAGAGCTGGCCACTGCAACA
GGAGACTCGAGCTCATCCGAAGCACAGAAGCCTGAGTGGAAAGAGCCCAACACAGATTGCACTGGAAACACGGCA
GCAGCTCTGGAGAGCTGCTACGGCACCCAAATTTGGTGCAGACTCAAGGCTTATCAGCAAACGATGGAAACATTT
GACAATGTCGTGGCCTGCATGCAAAGCCGCAAAAACCACCCAGCATACATCGATGACCTTTTGGTTTGGAAAGAG
CCTGGCCAAGATTTCCCCGGCTGCTTTGCTGAGTCGGCCAATGATCCTCAGCGTCTTGAGGCTTGCGTTGGCACG
GAAGCATTCTGCGAACGGAAATACTACGAAAACTTCGATGAGGTCTTTGATAATGCCGAGGCTTGCAGGAAGAGC
CGCAAGAGACGCCCAGGCCTTGCTGAGGGTCAAAACAAACCAGCCAGCGTTGAAACCCAGAACCCATCTACTGAA
GAGCATGAGTCCCACAGCGAGGAGGACGTTTCCTCTCCAGATAATGACGAGGAGCAGATCCCCTCTTCTAATAAA
TCTACTGTTTCTGACCAAGAGAAAGCTGAGGATTCTTTTACGGACGAAAAGGAGACTCCTTCGGAGCAACAGGTT
CCTTCTTCGAAGGACAACAGGGGGTCATCAGTCGACGGGCAGGACCCTCCTACCGAGAAGCAGGACCCTCTGGCG
GATGACAGTAATGAAGCTTCCATGGAAGGGCACGACCGTCCCGTGGACGAAAATAAGGAGACTACAGGCGAAGAG
CAGAGCCATTCCCCGAACGAGAAAGGAAAGCCTTTCACCGAAGGGCCAGGCAATCCCGTGGACGAAAACAAGGAG
GCTTCAACCGGAGAGCAGAGCAATCCCTCGGACGAGAGTAAAGGTGCTTCCACTAAAGGGCAAGGCCATCCTGCG
GATACGGATGGAGAGACTTCTACCAAGAGTCAGGATCCTCCTGCGGAGAAACAGGATCCTCTCGTGAATAATGAC
AACGAGGCTTCGGAAGAGAAAGGTAATCCCGTGGACGATAACAAGGAAGTTTCATCAGCCGAAGAGCAGAGCCAT
CCACCGAACGAAGACAAAGATGCTTCCAAGGAAGAGCAAGGCCATCCCTCAGACGACCAAGAGGAATCCTCTGCC
GAGAGGAAAGATCCTACCGCAGACGGCGACGACGACTCTGAGACCGAAGAGCAAGGCCCTCAGGTGGACAGAAAG
AAATGGAGACTTCCCAGACTGGATTCCCCATCCTGCTCAGGACTACTAGGTCATGCGCTCAGGTTCGACGAAAAA
TGCGTGGGCACAGAGCTCTGGTGTGATCAAGCATTCTACAACCTGACGAGCGACAAGTTCGCCGACGCCAAAGAG
TGCAAGAAAAGTCGAGGGCTTAAGATGCCATCCTACGTGGGCGCGTGGAAAGAAGCCAAGAATTCCCCAGAAGAC
TGCTTCTTCGGTGCCGAAATGTTCACCGAGGATTGCGTCGGCACCGAAATATGGTGCAGCAGAGATTCCTACACC
CCTGAGAGTCTTCAGGAGAATTATACCTCCCCTGAGGAGTGCAAGGAACTCCGCTACAACCGACCTATAGACGAG
GAGGTCATCGCCACGCTGGCAACGAACATGAGCAGTATTGTAGATGGCACTCATAGCGACATCATCCCGAGCAAC
GCAACATATGTCTGTTGGATACAAGGGAAAGCTGGAGACAGTCTATTCTGTGACTGGCAACTACCCAGCGATTGC
GAGTACGGGGCTGGATGCTCTCGTGTGGAAGACTTGCCCGATTTCTGTGACAATAACAAGGGATGTGGTTCTTGC
TTCATCGGCAAAACCACAAAGAACTTTGTCTGTTATATGCCTCAGGCCAACGAACTGACCGAAATGGGACGAGGT
GTCTGTCGACAGACGTGCTTAATATCCGCAGAAAATGCCCTGAACGGTACGGTCCAGGACTACCATGAGGCTCTC
GTGGAGAAAGCCTGTGAACTTTATTGTTAG
Gene >Ophio5|5709
ATGTTCTACCCTCTCCTCCTCGCCGCTCTGACGGTGCTGCAGTGTGTGGTTCATGGTATTCCAATAACAGAAGAT
GAGGAACTCTTCTGCGAGCCCGGCCTATCTGAAGTCGTTCCTGAAGCTGGCGTGCAACCGGATGATCCCAGGCTC
GAGACCACGAGCGTTGGACTGACAGGCCCTCAAGTTTCACTTCTCGTCACCAAGGGCGCCAAGGGAGCTGGTCTC
GACTCGAATGTTGCGGAAAAACTGGCGCTGATGGCCTCGAGGGCCGCGACGAGCGAGGGCATCAGGTCCGCTAAT
GAGTTCGTCAGAGTCGTCGGCGCCGTCAGCGTCTCGGCCGCCGTTGCCGCCCCCCGTAACGCGTCTTCTGCCGTC
TGCGCTATGGGTGCGATCGAAGGTCTCGTCCTCGTCAACATGGGAGACTCGCCGGCATCCCGCTGCCTTATTACC
GCTGCCGTTGTTGCCGCATCGTCGGGCGAAGACCGGGAAGCCGTCACGAAGATCACCGAAAACACTGCCAGAGCG
GTGATTCGAAACGAAAGCTCCATCGATGCAAGTGCCGTCACGACTGAGGCTTCGCTGGGTTGCCAAACAGAAATG
TGCCAGGTCGGTATCAAGGCGGCCATCCAGCTCATTAGCAGCGGGTTCAGCGTCAAGACAGCTTTGACGCTCTGC
GTGGCCGTCAATACCGCTGCCAAGTACGGTATTAAGCTTGAAATATATGCCGAGATGCTTGTCCAGCAAATTCGG
CTGCTCGGCCAGGGAGTCGAGCCTACTAGGGCAGCTCTCAAGGTTGTGGAAGCTACGCAGAGGCTCAAACAGATG
GCTCAAGCTGCGACAGACGTCAAAAACGTGACACTCGAGGCCGCCAAAGAGATGGAGAGCCTGCCGTCGCCGGAT
CTGTCTGAATTGGCTCATGTGTCGGCCGACAGTCCCAAGGCTCAGATGAGCCATCAGATTAGCATGAACATCTCC
GCTTCTTCGACGAACCAAGACTTAACCGCTATTGAAACGAGAAAGACGACTTCTATTGAGGAGGTGAGCCGCGAT
ATTGGCCAACCTTCGCTAAGCAAGACCCATGCCGTTATTCAAGCAACCCAAAGCTCATTCTCCTCTCAAATAATG
GAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCAAAAGGCTCAGATGAGCCATCAGATTAGC
ATGAATATCTCCGCTTCTTCGACGGACCAAGACTTAGCCGCTATCGAAACGAGAAAGACGACTTCTATTGAGGAG
GTGAGCCGCGATATTGGCCAACCTTCGCCGAGCAAGACCCATGCCGTCATTCAAGCAACTCAAAGCTTATTTTCC
TCTCCAATGATGGAATCTTCTTCGGCCGCCCCGATGGCTAAAGTGACGACTGCCGCCCTAAAGGCTCAGATAAGC
CATCAGATCAGCATGAATATTTCCGCTTCTTCGACGAACCAAGACTTTACCGCTGTTGAAACGAGAAAGACAACT
TCTACTGACGTGAGCCGCTATATTGGCCAACCTTTGCTAAGCAAGACCCATGCCGTCATTCAAGCAACTCGAAGC
TTATTCTCCTCTCAAACGATGGAATCTTCTTCGGCCGTCCCGATGACCAAAGTCACGACTGCCGCCCAAATAGTC
AAGGTCTCTTCCTCTATTTTGACTTCTACAAGTTCTCTCACAAGTCGAATACCGAACCAGTCTTCACACCGTATT
GTTGAGAGCTCCCTGACTTCTGCAATGTTGGGGGACAAGGATGCTACGCAAGTAGCCAGAGTCGCCCAAATAGCC
AAGGCCTCTTCCTCTATTTCGACGTTTATAAGTTCTCTCACAAGTCGAATACCGAACCAATCTTCACACCGTATA
GTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAAACA
GTCAAGGCCTCTCCCTCTATTTCGACGTCTATAAGTTCTCTCACAAGTCGAATACCGAATCAGTCTTCACACCGT
ATAGTTGAGAGCTCCCTGACTTCTTCTTCAATGTTGAGGGACACGGATGCTGCGCAAGTAGCCAGAGTCGCACAA
ACAGTCAAGGCCTCTTCCTCTATTTCGACGTCTACAAGTTCTCTCACAAGTCGAATACCCAATCAGTCTTCACAC
CGTATAGTTGAGAGCTCCCTGACTTCTTCTTCTTCTATGTTGTTGAGGGACACAGATGCTGCGCAAGTAGCCAGA
GTCGCGGCCTCACCTGCTCTTGCCACTGGGTTTTCCACTTCGGTTCAAGCTATCGAGCATTCGGCGACTACTATG
ATGGCCAACATCTTACCCCCTGTCCAAGTGGCCGTTGTCTCTTCCACGTCTCTACCGACGGAGCTTTCCAAGACA
ACTGATGGGCCGCTTGCTCCCATCACGCAAAGTACACCCTCTACCCTAGCACTAGCAGTCGCCGTCACTTCCTTT
TCTCCGACAATGAAGTCGTCCACCTCCTTTTCGCCCGAGAATACTTCCACGGTCAACCAGCAACCGCCAGCGAAC
GTTGCCGACTCTCAAGAAAACCAAGCTCAGAGCGCGGAATCAAAGGCTGGGACGATCAAGCACGAGAGCTCATCC
GAGACTGTCGAGAAGCCTGCAACTTCAGATGCCGAGACCGCAGCTGTCACTCTGCAGCCAGCGCCATCAAGGCCG
TGGCGAGACCCCGATACACTCTCGCCGGAGTGTATTGACTCGCTTGAGGAGGAATGTGTAGGCACCGAGGTCTGG
TGTGACCGAGATTATTACCAAAGCTCTGACGAGTTTTATGCGTACGCTGACGCTGCTGCGTGTAAGCAGAGCCGC
ACCAAGAGGCCAACGGTAAGTGAGCCAAGGGGGAGCAAAGATGCACCCAGTCTTGTTGTCTGCATTGTACAGCCG
CTGACTGTCAGAACAAGACCGCCCCTGGGCCCGCGGACATGCACCCTGAAGAGCCGAACATCACGACCGACATCT
CGAAGCCGGAGAGCAAGACAAACGACCCGACTCCAGCAATGACCCAGGCCCAGGACTCAGAGCTGGCCACTGCAA
CAGGAGACTCGAGCTCATCCGAAGCACAGAAGCCTGAGTGGAAAGAGCCCAACACAGATTGCACTGGAAACACGG
CAGCAGCTCTGGAGAGCTGCTACGGCACCCAAATTTGGTGCAGACTCAAGGCTTATCAGCAAACGATGGAAACAT
TTGACAATGTCGTGGCCTGCATGCAAAGCCGCAAAAACCACCCAGCATACATCGATGACCTTTTGGTTTGGAAAG
AGCCTGGCCAAGATTTCCCCGGCTGCTTTGCTGAGTCGGCCAATGATCCTCAGCGTCTTGAGGCTTGCGTTGGCA
CGGAAGCATTCTGCGAACGGAAATACTACGAAAACTTCGATGAGGTCTTTGATAATGCCGAGGCTTGCAGGAAGA
GCCGCAAGAGACGCCCAGGCCTTGCTGAGGGTCAAAACAAACCAGCCAGCGTTGAAACCCAGAACCCATCTACTG
AAGAGCATGAGTCCCACAGCGAGGAGGACGTTTCCTCTCCAGATAATGACGAGGAGCAGATCCCCTCTTCTAATA
AATCTACTGTTTCTGACCAAGAGAAAGCTGAGGATTCTTTTACGGACGAAAAGGAGACTCCTTCGGAGCAACAGG
TTCCTTCTTCGAAGGACAACAGGGGGTCATCAGTCGACGGGCAGGACCCTCCTACCGAGAAGCAGGACCCTCTGG
CGGATGACAGTAATGAAGCTTCCATGGAAGGGCACGACCGTCCCGTGGACGAAAATAAGGAGACTACAGGCGAAG
AGCAGAGCCATTCCCCGAACGAGAAAGGAAAGCCTTTCACCGAAGGGCCAGGCAATCCCGTGGACGAAAACAAGG
AGGCTTCAACCGGAGAGCAGAGCAATCCCTCGGACGAGAGTAAAGGTGCTTCCACTAAAGGGCAAGGCCATCCTG
CGGATACGGATGGAGAGACTTCTACCAAGAGTCAGGATCCTCCTGCGGAGAAACAGGATCCTCTCGTGAATAATG
ACAACGAGGCTTCGGAAGAGAAAGGTAATCCCGTGGACGATAACAAGGAAGTTTCATCAGCCGAAGAGCAGAGCC
ATCCACCGAACGAAGACAAAGATGCTTCCAAGGAAGAGCAAGGCCATCCCTCAGACGACCAAGAGGAATCCTCTG
CCGAGAGGAAAGATCCTACCGCAGACGGCGACGACGACTCTGAGACCGAAGAGCAAGGCCCTCAGGTGGACAGAA
AGAAATGGAGACTTCCCAGACTGGATTCCCCATCCTGCTCAGGACTACTAGGTCATGCGCTCAGGTTCGACGAAA
AATGCGTGGGCACAGAGCTCTGGTGTGATCAAGCATTCTACAACCTGACGAGCGACAAGTTCGCCGACGCCAAAG
AGTGCAAGAAAAGTCGAGGGCTTAAGATGCCATCCTACGTGGGCGCGTGGAAAGAAGCCAAGAATTCCCCAGAAG
ACTGCTTCTTCGGTGCCGAAATGTTCACCGAGGATTGCGTCGGCACCGAAATATGGTGCAGCAGAGATTCCTACA
CCCCTGAGAGTCTTCAGGAGAATTATACCTCCCCTGAGGAGTGCAAGGAACTCCGCTACAACCGACCTATAGACG
AGGAGGTCATCGCCACGCTGGCAACGGTACGTCCGTTTCATCACATCAGTTGCGAGTATTGAGCTGACAAGGCGC
GAAACAATAGAACATGAGCAGTATTGTAGATGGCACTCATAGCGACATCATCCCGAGCAACGCAACATATGTCTG
TTGGATACAAGTAAGCCCATCTCGATTCACCATATGTAGACATTTGGCTTGGCGGCACGCCGACTGACAGGACGC
GTAGGGGAAAGCTGGAGACAGTCTATTCTGTGACTGGCAACTACCCAGCGATTGCGAGTACGGGGCTGGATGCTC
TCGTGTGGAAGACTTGCCCGATTTCTGTGACAATAACAAGGGATGTGGTTCTTGCTTCATCGGCAAAACCACAAA
GGTCCGTATAGAGCTTTCTCCTCAACGAACCGTCACGATGCTGCAGACTACGGACTAACAGCCGCATTCCGTTCC
AGAACTTTGTCTGTTATATGCCTCAGGCCAACGAACTGACCGAAATGGGACGAGGTGTCTGTCGACAGACGTGCT
TAATATCCGCAGAAAATGCCCTGAACGGTACGGTCCAGGACTACCATGAGGCTCTCGTGGAGAAAGCCTGTGAAC
TTTATTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail