Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5702
Gene name
Locationscaffold_474:13357..14416
Strand+
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 38.41 18.78 58.04
CcL In ants, during behavior modification 59.26 31.51 87.01
CcD In ants, recently dead 58.46 30.89 86.02

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.065433 no
SC16a CcD 0.081671 no
CcL CcD 0.963879 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5702
MAPARRPAKKTKPGGVTAALSTDELPSPFKRPPEVLQSFVAGLVERHIYVTHIDSQPAVFKRNIFLVPVAMNLCI
SLLFVWRMYAVLPWYWQLVLSALGYVSEATFAASQSSWPELAREIGRRGLTMFIDFVLFVCVWHWPVDFAAGRRH
GNPMLWRRRVGFRDKEIYVRRSRKWDEAVGDVLADSDSRNIITAYIRQATSPMLQDQKTGYLLMDAAWDLDWEAM
VYAHDLVDKKHIALEAFRNVVLLHHRDYGWLCYDLKAGAEIDSEDKRRQVFAFRDALTSMGKEDLFYRWVETVQF
ETTQPGGFGTAQQEATAKKIREMFETEHVNFDELWKEATGGKQAFSSTESTE
Coding >Ophio5|5702
ATGGCTCCCGCCCGCCGACCAGCTAAAAAGACCAAGCCCGGAGGCGTCACGGCGGCCTTATCCACAGACGAGCTT
CCATCACCGTTCAAGCGGCCGCCCGAAGTGCTGCAGTCCTTCGTCGCCGGACTCGTAGAGCGACACATTTACGTG
ACGCACATCGACTCTCAGCCGGCCGTCTTCAAGCGCAACATTTTTCTCGTGCCCGTGGCGATGAATTTATGCATT
TCGCTGCTGTTCGTCTGGCGCATGTACGCTGTGCTTCCTTGGTACTGGCAGCTCGTGCTCTCGGCGCTGGGGTAT
GTTAGTGAAGCTACCTTTGCTGCTTCGCAATCCAGCTGGCCCGAACTGGCTCGCGAGATTGGTCGCCGTGGCCTG
ACCATGTTCATCGACTTCGTCCTCTTCGTTTGCGTCTGGCACTGGCCCGTCGACTTTGCTGCTGGTCGACGTCAT
GGGAACCCGATGCTCTGGCGCCGCCGCGTCGGCTTCCGCGACAAGGAGATATACGTGCGCCGTAGCCGCAAATGG
GACGAGGCCGTTGGTGATGTCTTGGCCGACTCCGACTCGCGCAACATCATCACCGCCTACATCCGCCAGGCTACC
TCGCCCATGCTGCAGGACCAGAAGACGGGCTACCTGCTCATGGATGCCGCCTGGGATCTCGACTGGGAGGCCATG
GTTTATGCCCACGATCTGGTCGACAAGAAGCATATCGCCCTCGAGGCCTTTCGAAACGTGGTGCTGCTGCATCAC
CGAGACTACGGGTGGTTGTGCTACGACCTCAAGGCCGGCGCCGAGATCGACTCAGAGGACAAGAGGAGACAGGTG
TTTGCCTTTCGCGACGCCCTCACCTCCATGGGGAAGGAGGATCTGTTCTACCGTTGGGTCGAGACGGTGCAGTTC
GAGACGACGCAGCCGGGTGGCTTTGGCACGGCGCAGCAGGAGGCGACTGCGAAAAAGATTCGAGAAATGTTTGAA
ACCGAGCATGTCAACTTTGACGAGTTGTGGAAAGAGGCAACTGGCGGCAAGCAGGCGTTTAGTAGCACAGAAAGT
ACAGAA
Transcript >Ophio5|5702
ATGGCTCCCGCCCGCCGACCAGCTAAAAAGACCAAGCCCGGAGGCGTCACGGCGGCCTTATCCACAGACGAGCTT
CCATCACCGTTCAAGCGGCCGCCCGAAGTGCTGCAGTCCTTCGTCGCCGGACTCGTAGAGCGACACATTTACGTG
ACGCACATCGACTCTCAGCCGGCCGTCTTCAAGCGCAACATTTTTCTCGTGCCCGTGGCGATGAATTTATGCATT
TCGCTGCTGTTCGTCTGGCGCATGTACGCTGTGCTTCCTTGGTACTGGCAGCTCGTGCTCTCGGCGCTGGGGTAT
GTTAGTGAAGCTACCTTTGCTGCTTCGCAATCCAGCTGGCCCGAACTGGCTCGCGAGATTGGTCGCCGTGGCCTG
ACCATGTTCATCGACTTCGTCCTCTTCGTTTGCGTCTGGCACTGGCCCGTCGACTTTGCTGCTGGTCGACGTCAT
GGGAACCCGATGCTCTGGCGCCGCCGCGTCGGCTTCCGCGACAAGGAGATATACGTGCGCCGTAGCCGCAAATGG
GACGAGGCCGTTGGTGATGTCTTGGCCGACTCCGACTCGCGCAACATCATCACCGCCTACATCCGCCAGGCTACC
TCGCCCATGCTGCAGGACCAGAAGACGGGCTACCTGCTCATGGATGCCGCCTGGGATCTCGACTGGGAGGCCATG
GTTTATGCCCACGATCTGGTCGACAAGAAGCATATCGCCCTCGAGGCCTTTCGAAACGTGGTGCTGCTGCATCAC
CGAGACTACGGGTGGTTGTGCTACGACCTCAAGGCCGGCGCCGAGATCGACTCAGAGGACAAGAGGAGACAGGTG
TTTGCCTTTCGCGACGCCCTCACCTCCATGGGGAAGGAGGATCTGTTCTACCGTTGGGTCGAGACGGTGCAGTTC
GAGACGACGCAGCCGGGTGGCTTTGGCACGGCGCAGCAGGAGGCGACTGCGAAAAAGATTCGAGAAATGTTTGAA
ACCGAGCATGTCAACTTTGACGAGTTGTGGAAAGAGGCAACTGGCGGCAAGCAGGCGTTTAGTAGCACAGAAAGT
ACAGAATAG
Gene >Ophio5|5702
ATGGCTCCCGCCCGCCGACCAGCTAAAAAGACCAAGCCCGGAGGCGTCACGGCGGCCTTATCCACAGACGAGCTT
CCATCACCGTTCAAGCGGCCGCCCGAAGTGCTGCAGTCCTTCGTCGCCGGACTCGTAGAGCGACACATTTACGTG
ACGCACATCGACTCTCAGCCGGCCGTCTTCAAGCGCAACATTTTTCTCGTGCCCGTGGCGATGAATTTATGCATT
TCGCTGCTGTTCGTCTGGCGCATGTACGCTGTGCTTCCTTGGTACTGGCAGCTCGTGCTCTCGGCGCTGGGGTAT
GTTAGTGAAGCTACCTTTGCTGCTTCGCAATCCAGCTGGCCCGAACTGGCTCGCGAGATTGGTCGCCGTGGCCTG
ACCATGTTCATCGACTTCGTCCTCTTCGTTTGCGTCTGGCACTGGCCCGTCGACTTTGCTGCTGGTCGACGTCAT
GGGAACCCGATGCTCTGGCGCCGCCGCGTCGGCTTCCGCGACAAGGAGATATACGTGCGCCGTAGCCGCAAATGG
GACGAGGCCGTTGGTGATGTCTTGGCCGACTCCGACTCGCGCAACATCATCACCGCCTACATCCGCCAGGCTACC
TCGCCCATGCTGCAGGACCAGAAGACGGGCTACCTGCTCATGGATGCCGCCTGGGATCTCGACTGGGAGGCCATG
GTTTATGCCCACGATCTGGTCGACAAGAAGCATATCGCCCTCGAGGCCTTTCGAAACGTGGTGCTGCTGCATCAC
CGAGACTACGGGTGGTTGTGCTACGACCTCAAGGCCGGCGCCGAGATCGACTCAGAGGACAAGAGGAGACAGGTG
TTTGCCTTTCGCGACGCCCTCACCTCCATGGGGAAGGAGGATCTGTTCTACCGTTGGGTCGAGACGGTGCAGTTC
GAGACGACGCAGCCGGGTGGCTTTGGCACGGCGCAGCAGGAGGCGACTGCGAAAAAGATTCGAGAAATGTTTGAA
ACCGAGCATGTCAACTTTGACGAGTTGTGGAAAGAGGCAACTGGCGGCAAGCAGGCGTTTAGTAGCACAGAAAGT
ACAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail