Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5697
Gene name
Locationscaffold_473:14513..15824
Strand-
Gene length (bp)1311
Transcript length (bp)1311
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5434 0.447 0.0306 0.5016 0.2718 0.0171 0.2462 0.1478 0.0688 0.109

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6109
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3588
Ophiocordyceps australis 1348a (Ghana) OphauG2|3589
Ophiocordyceps australis map64 (Brazil) OphauB2|6953
Ophiocordyceps kimflemingae Ophio5|5697 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3598

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5697
MQQLPPLCSPSAGQQRNEGPPPRQSTTTTTSSSSSSSSSSNSSDDDSPPAERRPTGILPDCRRRRRRRRRRHNSL
YHEPPGTRTRKTTTTTSTTTTTTPSRIAPVLSSPPNRNHAGPGQNGTDHAAGQGPKPARGPLESPTTAGQTASPG
RTLIGRTWHAWSSASYCSSSSSSSSSPSSSPSSSSYSSSSSSSSSPAFFALGRRPCPPRYWDPRRRRCPPVMHRR
HDPDSGTDSPRSGTDSPLSDSDASAFPPRRISRSRTFHNINPPPFPLASHHHQHQPRHFSVGDIFGPSSFDPHNL
PPPPPPPPHHHHHHPPPPPPCAESSLPHPPQTTHYWTSHRTRRLEYAAIDSATRGLRGWLRRHLVPDCFGPQLVA
FDDDSGSVRRYRLELPDDDEDEDEDDDDDSLDDGELSSERSAKKRRPGWQFWHHLRKTTSL
Coding >Ophio5|5697
ATGCAGCAACTGCCGCCACTCTGCAGCCCAAGCGCCGGACAGCAAAGGAACGAGGGTCCACCGCCTCGACAGAGT
ACTACTACTACTACTAGCAGCAGCAGCAGCAGCAGCAGTAGCAGCAACAGTAGCGACGACGATAGCCCACCGGCC
GAGCGTCGTCCAACTGGCATTCTTCCAGACTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGCCATAACAGCCTC
TACCACGAACCGCCAGGGACGAGGACGAGGAAGACGACGACGACGACTTCAACGACGACGACGACGACGCCTTCC
CGCATCGCCCCCGTCCTTTCCTCACCGCCGAATCGTAATCATGCTGGGCCTGGGCAGAATGGGACCGATCATGCT
GCTGGCCAGGGTCCGAAGCCAGCCCGCGGCCCGTTGGAGTCGCCGACGACGGCCGGTCAGACCGCAAGTCCTGGA
CGAACTCTAATAGGACGGACATGGCATGCATGGTCGTCTGCCTCCTATTGTTCATCTTCATCTTCTTCTTCATCT
TCTCCTTCTTCTTCGCCGTCTTCTTCTTCTTATTCTTCTTCTTCTTCTTCCTCTTCCTCTCCCGCCTTTTTCGCC
CTCGGTCGGCGCCCTTGTCCACCTCGCTATTGGGACCCGCGCCGCCGCCGCTGCCCACCCGTCATGCACCGGCGC
CACGACCCCGACTCCGGCACCGATTCGCCCCGATCCGGAACCGACTCCCCACTATCCGACTCGGACGCTTCCGCC
TTTCCCCCCCGGCGCATTTCCCGCTCGCGTACCTTTCACAACATCAATCCTCCCCCTTTTCCTCTCGCATCACAC
CACCACCAACACCAACCCAGACACTTTTCCGTCGGCGACATCTTCGGCCCCTCCTCTTTCGACCCTCATAACCTT
CCTCCTCCTCCTCCCCCTCCTCCTCATCATCATCATCATCATCCTCCTCCTCCTCCTCCTTGTGCGGAATCCTCC
CTCCCCCACCCCCCGCAAACAACCCATTACTGGACCAGCCATCGCACCCGCCGGCTTGAATACGCCGCCATCGAT
TCGGCTACCCGCGGTCTGCGCGGCTGGCTCCGTCGCCATCTCGTTCCCGATTGCTTCGGCCCGCAACTCGTCGCC
TTTGACGACGACTCCGGTAGCGTTCGTCGATACCGTCTCGAGCTTCCCGACGACGACGAAGACGAAGACGAAGAC
GACGACGACGACTCGCTCGACGACGGAGAGCTATCGTCGGAGCGGTCTGCCAAGAAGAGGCGGCCCGGCTGGCAA
TTTTGGCACCACCTGCGCAAGACAACGTCCTTG
Transcript >Ophio5|5697
ATGCAGCAACTGCCGCCACTCTGCAGCCCAAGCGCCGGACAGCAAAGGAACGAGGGTCCACCGCCTCGACAGAGT
ACTACTACTACTACTAGCAGCAGCAGCAGCAGCAGCAGTAGCAGCAACAGTAGCGACGACGATAGCCCACCGGCC
GAGCGTCGTCCAACTGGCATTCTTCCAGACTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGCCATAACAGCCTC
TACCACGAACCGCCAGGGACGAGGACGAGGAAGACGACGACGACGACTTCAACGACGACGACGACGACGCCTTCC
CGCATCGCCCCCGTCCTTTCCTCACCGCCGAATCGTAATCATGCTGGGCCTGGGCAGAATGGGACCGATCATGCT
GCTGGCCAGGGTCCGAAGCCAGCCCGCGGCCCGTTGGAGTCGCCGACGACGGCCGGTCAGACCGCAAGTCCTGGA
CGAACTCTAATAGGACGGACATGGCATGCATGGTCGTCTGCCTCCTATTGTTCATCTTCATCTTCTTCTTCATCT
TCTCCTTCTTCTTCGCCGTCTTCTTCTTCTTATTCTTCTTCTTCTTCTTCCTCTTCCTCTCCCGCCTTTTTCGCC
CTCGGTCGGCGCCCTTGTCCACCTCGCTATTGGGACCCGCGCCGCCGCCGCTGCCCACCCGTCATGCACCGGCGC
CACGACCCCGACTCCGGCACCGATTCGCCCCGATCCGGAACCGACTCCCCACTATCCGACTCGGACGCTTCCGCC
TTTCCCCCCCGGCGCATTTCCCGCTCGCGTACCTTTCACAACATCAATCCTCCCCCTTTTCCTCTCGCATCACAC
CACCACCAACACCAACCCAGACACTTTTCCGTCGGCGACATCTTCGGCCCCTCCTCTTTCGACCCTCATAACCTT
CCTCCTCCTCCTCCCCCTCCTCCTCATCATCATCATCATCATCCTCCTCCTCCTCCTCCTTGTGCGGAATCCTCC
CTCCCCCACCCCCCGCAAACAACCCATTACTGGACCAGCCATCGCACCCGCCGGCTTGAATACGCCGCCATCGAT
TCGGCTACCCGCGGTCTGCGCGGCTGGCTCCGTCGCCATCTCGTTCCCGATTGCTTCGGCCCGCAACTCGTCGCC
TTTGACGACGACTCCGGTAGCGTTCGTCGATACCGTCTCGAGCTTCCCGACGACGACGAAGACGAAGACGAAGAC
GACGACGACGACTCGCTCGACGACGGAGAGCTATCGTCGGAGCGGTCTGCCAAGAAGAGGCGGCCCGGCTGGCAA
TTTTGGCACCACCTGCGCAAGACAACGTCCTTGTAG
Gene >Ophio5|5697
ATGCAGCAACTGCCGCCACTCTGCAGCCCAAGCGCCGGACAGCAAAGGAACGAGGGTCCACCGCCTCGACAGAGT
ACTACTACTACTACTAGCAGCAGCAGCAGCAGCAGCAGTAGCAGCAACAGTAGCGACGACGATAGCCCACCGGCC
GAGCGTCGTCCAACTGGCATTCTTCCAGACTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGCCATAACAGCCTC
TACCACGAACCGCCAGGGACGAGGACGAGGAAGACGACGACGACGACTTCAACGACGACGACGACGACGCCTTCC
CGCATCGCCCCCGTCCTTTCCTCACCGCCGAATCGTAATCATGCTGGGCCTGGGCAGAATGGGACCGATCATGCT
GCTGGCCAGGGTCCGAAGCCAGCCCGCGGCCCGTTGGAGTCGCCGACGACGGCCGGTCAGACCGCAAGTCCTGGA
CGAACTCTAATAGGACGGACATGGCATGCATGGTCGTCTGCCTCCTATTGTTCATCTTCATCTTCTTCTTCATCT
TCTCCTTCTTCTTCGCCGTCTTCTTCTTCTTATTCTTCTTCTTCTTCTTCCTCTTCCTCTCCCGCCTTTTTCGCC
CTCGGTCGGCGCCCTTGTCCACCTCGCTATTGGGACCCGCGCCGCCGCCGCTGCCCACCCGTCATGCACCGGCGC
CACGACCCCGACTCCGGCACCGATTCGCCCCGATCCGGAACCGACTCCCCACTATCCGACTCGGACGCTTCCGCC
TTTCCCCCCCGGCGCATTTCCCGCTCGCGTACCTTTCACAACATCAATCCTCCCCCTTTTCCTCTCGCATCACAC
CACCACCAACACCAACCCAGACACTTTTCCGTCGGCGACATCTTCGGCCCCTCCTCTTTCGACCCTCATAACCTT
CCTCCTCCTCCTCCCCCTCCTCCTCATCATCATCATCATCATCCTCCTCCTCCTCCTCCTTGTGCGGAATCCTCC
CTCCCCCACCCCCCGCAAACAACCCATTACTGGACCAGCCATCGCACCCGCCGGCTTGAATACGCCGCCATCGAT
TCGGCTACCCGCGGTCTGCGCGGCTGGCTCCGTCGCCATCTCGTTCCCGATTGCTTCGGCCCGCAACTCGTCGCC
TTTGACGACGACTCCGGTAGCGTTCGTCGATACCGTCTCGAGCTTCCCGACGACGACGAAGACGAAGACGAAGAC
GACGACGACGACTCGCTCGACGACGGAGAGCTATCGTCGGAGCGGTCTGCCAAGAAGAGGCGGCCCGGCTGGCAA
TTTTGGCACCACCTGCGCAAGACAACGTCCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail