Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5695
Gene name
Locationscaffold_473:11317..11754
Strand-
Gene length (bp)437
Transcript length (bp)279
Coding sequence length (bp)276
Protein length (aa) 92

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08285 DPM3 Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) 5.3E-35 1 90

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q76NT6|DPM3_DICDI Dolichol-phosphate mannosyltransferase subunit 3 OS=Dictyostelium discoideum GN=dpm3 PE=3 SV=1 1 91 3.0E-07
sp|Q3ZC71|DPM3_BOVIN Dolichol-phosphate mannosyltransferase subunit 3 OS=Bos taurus GN=DPM3 PE=3 SV=1 1 89 7.0E-06

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0043413 macromolecule glycosylation No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0008150 biological_process No
GO:0070085 glycosylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5695
MTRAQQTISLGLLVSSLYLALYLELIPLPPLVQHTIVPVLPFWALVSFGALILFRLGLGLVTFNDVPEAHKELRL
EIDLAKADLRTRGVDVD
Coding >Ophio5|5695
ATGACGCGCGCCCAGCAGACCATCTCTCTCGGACTCCTCGTCTCCTCTCTCTACCTCGCCCTCTACCTCGAGTTG
ATACCGCTACCGCCCCTTGTTCAGCATACCATCGTCCCTGTCCTACCCTTTTGGGCCCTCGTCTCCTTCGGCGCC
CTCATTCTCTTCCGCCTCGGTCTCGGCCTCGTCACCTTCAACGACGTCCCGGAGGCTCACAAGGAGCTGAGGCTC
GAGATCGACTTGGCAAAAGCAGATCTAAGAACGCGTGGCGTCGATGTCGAT
Transcript >Ophio5|5695
ATGACGCGCGCCCAGCAGACCATCTCTCTCGGACTCCTCGTCTCCTCTCTCTACCTCGCCCTCTACCTCGAGTTG
ATACCGCTACCGCCCCTTGTTCAGCATACCATCGTCCCTGTCCTACCCTTTTGGGCCCTCGTCTCCTTCGGCGCC
CTCATTCTCTTCCGCCTCGGTCTCGGCCTCGTCACCTTCAACGACGTCCCGGAGGCTCACAAGGAGCTGAGGCTC
GAGATCGACTTGGCAAAAGCAGATCTAAGAACGCGTGGCGTCGATGTCGATTGA
Gene >Ophio5|5695
ATGACGCGCGCCCAGCAGACCATCTCTCTCGGACTCCTCGTCTCCTCTGTACGCCTCCTTTTCAGCTGCTGTGTC
CCCCCCCCCCCCCCCCCCCCCCCCCCTTTTTTTTTTGGAGTACTGACCGACTCAGCTCTACCTCGCCCTCTACCT
CGAGTTGATACCGCTACCGCCCCTTGTTCAGCATACCATCGTCCCTGTCGTGCGTTCCCTTCGTCTTTTTTTCCT
TCTCTCCTCTCTCTCCCATCATTCTTCTCCGCTGACTTTGTTCCTTTCAGCTACCCTTTTGGGCCCTCGTCTCCT
TCGGCGCCCTCATTCTCTTCCGCCTCGGTCTCGGCCTCGTCACCTTCAACGACGTCCCGGAGGCTCACAAGGAGC
TGAGGCTCGAGATCGACTTGGCAAAAGCAGATCTAAGAACGCGTGGCGTCGATGTCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail