Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5692
Gene name
Locationscaffold_473:3265..4633
Strand-
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03595 SLAC1 Voltage-dependent anion channel 1.9E-85 98 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50537|MAE1_SCHPO Malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae1 PE=1 SV=1 88 451 6.0E-73
sp|O59815|MAE2_SCHPO Putative malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.06 PE=3 SV=1 88 452 5.0E-70
sp|A3QUP1|SSU1_TRIRU Sulfite efflux pump SSU1 OS=Trichophyton rubrum GN=SSU1 PE=2 SV=1 103 443 3.0E-20
sp|A3R044|SSU1_ARTBC Sulfite efflux pump SSU1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SSU1 PE=2 SV=1 103 443 5.0E-20
sp|C5G0E3|SSU1_ARTOC Sulfite efflux pump SSU1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SSU1 PE=3 SV=2 103 443 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50537|MAE1_SCHPO Malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae1 PE=1 SV=1 88 451 6.0E-73
sp|O59815|MAE2_SCHPO Putative malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.06 PE=3 SV=1 88 452 5.0E-70
sp|A3QUP1|SSU1_TRIRU Sulfite efflux pump SSU1 OS=Trichophyton rubrum GN=SSU1 PE=2 SV=1 103 443 3.0E-20
sp|A3R044|SSU1_ARTBC Sulfite efflux pump SSU1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SSU1 PE=2 SV=1 103 443 5.0E-20
sp|C5G0E3|SSU1_ARTOC Sulfite efflux pump SSU1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SSU1 PE=3 SV=2 103 443 8.0E-19
sp|Q58172|Y762_METJA Uncharacterized transporter MJ0762 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0762 PE=3 SV=1 92 448 2.0E-14
sp|Q57996|Y576_METJA Uncharacterized transporter MJ0576 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0576 PE=3 SV=1 73 419 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 133 155 22
3 170 192 22
4 199 221 22
5 236 258 22
6 270 292 22
7 347 369 22
8 381 403 22
9 413 435 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.63 0.00 1.36
CcL In ants, during behavior modification 145.16 14.32 275.99
CcD In ants, recently dead 6.99 2.25 11.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000535 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5692
MGTQVVTGHGVAMPEMRSWNNSGSSTRRNSFTAASDAFTSVSGSSFKGKTHQLSPGFYYYPGEKAGSVSRGGLEA
QPTQVDINDPNRPRLPLRQRLHHFTWAWYTLAMSTGGLAVLIFAQPHQFKGLRTIGLVLYVINLFIFTTITILLV
SRFFLHPGDLTRSLQHPREGFFFPTFFLAIATIITGTDRYVIPKNDVNLTWAIQGAFWTYLAFTLILAVGQYSYV
FASHSFGLQTMMPTWILPIFPIMLSGTIASVIADTQPDIAATPIIVAGLTCQGLGLSVAFMMYAHMVGRLMQSGL
PNREHRPGLFMCVGPPSFTALALIGMANGLPARASSTAEGTFLDTGVIRTVALLCAIFLWALSLWWFGIAAVSVI
LSPPEYFHLGWWAMVFPNTGFTLATISIGKALGSEPVSWVGTGMTIFIIITYLVVLFFNIRAVIVQDIMYPDRDE
DVVDH
Coding >Ophio5|5692
ATGGGTACCCAAGTCGTCACCGGACACGGCGTGGCCATGCCCGAGATGCGAAGCTGGAACAACTCGGGCTCCTCG
ACGCGACGAAACTCCTTCACCGCAGCCAGCGACGCCTTCACCTCGGTCAGTGGCAGCTCCTTCAAGGGTAAAACC
CATCAGCTCTCACCCGGATTCTACTACTATCCCGGCGAGAAGGCCGGATCCGTCTCCCGCGGCGGACTCGAGGCT
CAGCCGACACAAGTGGACATCAATGATCCGAACCGGCCCCGGCTGCCGTTGCGTCAGCGTCTTCACCACTTCACC
TGGGCGTGGTATACGCTGGCCATGAGTACCGGCGGTCTGGCCGTTCTCATCTTCGCCCAACCGCATCAGTTCAAG
GGCCTCCGGACCATCGGCCTCGTACTCTACGTCATCAACCTCTTCATCTTTACTACCATCACCATCCTTCTTGTC
TCCCGCTTCTTCCTTCATCCCGGTGATCTGACGCGGTCGCTACAGCATCCGCGAGAAGGCTTCTTCTTTCCCACC
TTCTTCCTCGCCATCGCCACCATCATCACCGGCACGGATCGCTATGTCATCCCCAAGAACGATGTTAACCTCACG
TGGGCCATCCAGGGCGCCTTCTGGACGTACCTCGCCTTCACCCTGATCCTGGCTGTCGGTCAGTACAGTTACGTC
TTCGCCTCCCACAGCTTCGGCCTGCAGACGATGATGCCGACCTGGATTCTGCCCATCTTCCCCATCATGCTGTCC
GGCACCATCGCCTCCGTCATCGCCGATACCCAGCCGGACATTGCGGCCACGCCCATCATCGTCGCCGGCCTCACC
TGTCAGGGCTTGGGACTGTCGGTCGCCTTCATGATGTACGCCCACATGGTCGGTCGCCTGATGCAATCCGGCCTT
CCCAACCGTGAGCATCGCCCGGGCCTCTTCATGTGCGTCGGTCCGCCCTCCTTCACCGCACTCGCCCTCATCGGT
ATGGCCAACGGACTGCCGGCCCGGGCGAGCTCCACTGCTGAGGGCACCTTTCTCGACACCGGCGTCATCCGAACC
GTCGCCCTCCTCTGCGCCATCTTTCTTTGGGCCCTCAGCTTGTGGTGGTTTGGCATCGCCGCCGTCTCCGTCATC
CTGTCGCCTCCCGAGTATTTCCATCTCGGCTGGTGGGCCATGGTCTTTCCCAACACCGGTTTCACTCTGGCTACC
ATTTCCATCGGCAAGGCATTGGGGAGCGAGCCCGTGTCGTGGGTTGGCACTGGCATGACCATCTTCATCATCATC
ACCTATTTGGTCGTCCTCTTCTTCAACATCCGCGCCGTCATTGTGCAGGACATTATGTACCCGGACAGAGACGAG
GACGTGGTAGACCAC
Transcript >Ophio5|5692
ATGGGTACCCAAGTCGTCACCGGACACGGCGTGGCCATGCCCGAGATGCGAAGCTGGAACAACTCGGGCTCCTCG
ACGCGACGAAACTCCTTCACCGCAGCCAGCGACGCCTTCACCTCGGTCAGTGGCAGCTCCTTCAAGGGTAAAACC
CATCAGCTCTCACCCGGATTCTACTACTATCCCGGCGAGAAGGCCGGATCCGTCTCCCGCGGCGGACTCGAGGCT
CAGCCGACACAAGTGGACATCAATGATCCGAACCGGCCCCGGCTGCCGTTGCGTCAGCGTCTTCACCACTTCACC
TGGGCGTGGTATACGCTGGCCATGAGTACCGGCGGTCTGGCCGTTCTCATCTTCGCCCAACCGCATCAGTTCAAG
GGCCTCCGGACCATCGGCCTCGTACTCTACGTCATCAACCTCTTCATCTTTACTACCATCACCATCCTTCTTGTC
TCCCGCTTCTTCCTTCATCCCGGTGATCTGACGCGGTCGCTACAGCATCCGCGAGAAGGCTTCTTCTTTCCCACC
TTCTTCCTCGCCATCGCCACCATCATCACCGGCACGGATCGCTATGTCATCCCCAAGAACGATGTTAACCTCACG
TGGGCCATCCAGGGCGCCTTCTGGACGTACCTCGCCTTCACCCTGATCCTGGCTGTCGGTCAGTACAGTTACGTC
TTCGCCTCCCACAGCTTCGGCCTGCAGACGATGATGCCGACCTGGATTCTGCCCATCTTCCCCATCATGCTGTCC
GGCACCATCGCCTCCGTCATCGCCGATACCCAGCCGGACATTGCGGCCACGCCCATCATCGTCGCCGGCCTCACC
TGTCAGGGCTTGGGACTGTCGGTCGCCTTCATGATGTACGCCCACATGGTCGGTCGCCTGATGCAATCCGGCCTT
CCCAACCGTGAGCATCGCCCGGGCCTCTTCATGTGCGTCGGTCCGCCCTCCTTCACCGCACTCGCCCTCATCGGT
ATGGCCAACGGACTGCCGGCCCGGGCGAGCTCCACTGCTGAGGGCACCTTTCTCGACACCGGCGTCATCCGAACC
GTCGCCCTCCTCTGCGCCATCTTTCTTTGGGCCCTCAGCTTGTGGTGGTTTGGCATCGCCGCCGTCTCCGTCATC
CTGTCGCCTCCCGAGTATTTCCATCTCGGCTGGTGGGCCATGGTCTTTCCCAACACCGGTTTCACTCTGGCTACC
ATTTCCATCGGCAAGGCATTGGGGAGCGAGCCCGTGTCGTGGGTTGGCACTGGCATGACCATCTTCATCATCATC
ACCTATTTGGTCGTCCTCTTCTTCAACATCCGCGCCGTCATTGTGCAGGACATTATGTACCCGGACAGAGACGAG
GACGTGGTAGACCACTAA
Gene >Ophio5|5692
ATGGGTACCCAAGTCGTCACCGGACACGGCGTGGCCATGCCCGAGATGCGAAGCTGGAACAACTCGGGCTCCTCG
ACGCGACGAAACTCCTTCACCGCAGCCAGCGACGCCTTCACCTCGGTCAGTGGCAGCTCCTTCAAGGGTAAAACC
CATCAGCTCTCACCCGGATTCTACTACTATCCCGGCGAGAAGGCCGGATCCGTCTCCCGCGGCGGACTCGAGGCT
CAGCCGACACAAGTGGACATCAATGATCCGAACCGGCCCCGGCTGCCGTTGCGTCAGCGTCTTCACCACTTCACC
TGGGCGTGGTATACGCTGGCCATGAGTACCGGCGGTCTGGCCGTTCTCATCTTCGCCCAACCGCATCAGTTCAAG
GGCCTCCGGACCATCGGCCTCGTACTCTACGTCATCAACCTCTTCATCTTTACTACCATCACCATCCTTCTTGTC
TCCCGCTTCTTCCTTCATCCCGGTGATCTGACGCGGTCGCTACAGCATCCGCGAGAAGGCTTCTTCTTTCCCACC
TTCTTCCTCGCCATCGCCACCATCATCACCGGCACGGATCGCTATGTCATCCCCAAGAACGATGTTAACCTCACG
TGGGCCATCCAGGGCGCCTTCTGGACGTACCTCGCCTTCACCCTGATCCTGGCTGTCGGTCAGTACAGTTACGTC
TTCGCCTCCCACAGCTTCGGCCTGCAGACGATGATGCCGACCTGGATTCTGCCCATCTTCCCCATCATGCTGTCC
GGCACCATCGCCTCCGTCATCGCCGATACCCAGCCGGACATTGCGGCCACGCCCATCATCGTCGCCGGCCTCACC
TGTCAGGGCTTGGGACTGTCGGTCGCCTTCATGATGTACGCCCACATGGTCGGTCGCCTGATGCAATCCGGCCTT
CCCAACCGTGAGCATCGCCCGGGCCTCTTCATGTGCGTCGGTCCGCCCTCCTTCACCGCACTCGCCCTCATCGGT
ATGGCCAACGGACTGCCGGCCCGGGCGAGCTCCACTGCTGAGGGCACCTTTCTCGACACCGGCGTCATCCGAACC
GTCGCCCTCCTCTGCGCCATCTTTCTTTGGGCCCTCAGCTTGTGGTGGTTTGGCATCGCCGCCGTCTCCGTCATC
CTGTCGCCTCCCGAGTATTTCCATCTCGGCTGGTGGGCCATGGTCTTTCCCAACACCGGTTTCACTCTGGCTACC
ATTTCCATCGGCAAGGCATTGGGGAGCGAGCCCGTGTCGTGGGTTGGCACTGGCATGACCATCTTCATCATCATC
ACCTATTTGGTCGTCCTCTTCTTCAACATCCGCGCCGTCATTGTGCAGGACATTATGTACCCGGACAGAGACGAG
GACGTGGTAGACCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail