Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5684
Gene name
Locationscaffold_470:14343..16058
Strand+
Gene length (bp)1715
Transcript length (bp)1650
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 4.0E-52 208 446
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 5.6E-40 55 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 39 548 0.0E+00
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 46 522 3.0E-139
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 46 519 1.0E-114
sp|P97997|MPPA_BLAEM Mitochondrial-processing peptidase subunit alpha OS=Blastocladiella emersonii PE=3 SV=1 47 500 1.0E-82
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 46 515 9.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 39 548 0.0E+00
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 46 522 3.0E-139
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 46 519 1.0E-114
sp|P97997|MPPA_BLAEM Mitochondrial-processing peptidase subunit alpha OS=Blastocladiella emersonii PE=3 SV=1 47 500 1.0E-82
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 46 515 9.0E-74
sp|Q9DC61|MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus GN=Pmpca PE=1 SV=1 46 515 7.0E-73
sp|Q10713|MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens GN=PMPCA PE=1 SV=2 46 515 2.0E-72
sp|P20069|MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus GN=Pmpca PE=1 SV=1 46 515 3.0E-71
sp|Q0P5M8|MPPA_BOVIN Mitochondrial-processing peptidase subunit alpha OS=Bos taurus GN=PMPCA PE=2 SV=1 46 505 9.0E-70
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 14 501 4.0E-61
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 40 500 2.0E-58
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 40 502 3.0E-58
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 21 533 2.0E-48
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 18 533 3.0E-48
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 46 503 7.0E-48
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 18 503 5.0E-47
sp|Q9P7X1|MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr1 PE=2 SV=1 27 511 6.0E-46
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 46 500 9.0E-46
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 46 503 5.0E-45
sp|Q4UML9|Y338_RICFE Uncharacterized zinc protease RF_0338 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0338 PE=3 SV=1 47 499 5.0E-43
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 46 496 7.0E-43
sp|P10507|MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS1 PE=1 SV=1 14 522 1.0E-42
sp|Q00302|MPPB_BLAEM Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1 27 503 7.0E-42
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 46 497 2.0E-41
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 48 503 2.0E-40
sp|Q92IX7|Y293_RICCN Uncharacterized zinc protease RC0293 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0293 PE=3 SV=1 47 502 9.0E-40
sp|Q1RJ61|Y522_RICBR Uncharacterized zinc protease RBE_0522 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0522 PE=3 SV=1 47 518 2.0E-39
sp|Q4W6B5|MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum GN=mppB PE=1 SV=1 46 500 3.0E-39
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 46 495 4.0E-39
sp|P0A5S9|Y2805_MYCBO Uncharacterized zinc protease Mb2805c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2805c PE=3 SV=1 48 503 3.0E-38
sp|P9WHT5|Y2782_MYCTU Uncharacterized zinc protease Rv2782c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2782c PE=1 SV=1 48 503 3.0E-38
sp|P9WHT4|Y2782_MYCTO Uncharacterized zinc protease MT2852 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2852 PE=3 SV=1 48 503 3.0E-37
sp|O32965|Y855_MYCLE Uncharacterized zinc protease ML0855 OS=Mycobacterium leprae (strain TN) GN=ML0855 PE=3 SV=1 48 503 6.0E-37
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 13 533 2.0E-36
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 50 510 3.0E-36
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 46 533 1.0E-35
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 13 533 3.0E-35
sp|Q68XF0|Y210_RICTY Uncharacterized zinc protease RT0210 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0210 PE=3 SV=1 47 505 1.0E-34
sp|O05945|Y219_RICPR Uncharacterized zinc protease RP219 OS=Rickettsia prowazekii (strain Madrid E) GN=RP219 PE=3 SV=1 47 502 2.0E-34
sp|Q04805|YMXG_BACSU Uncharacterized zinc protease YmxG OS=Bacillus subtilis (strain 168) GN=ymxG PE=3 SV=3 52 496 9.0E-34
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 46 533 6.0E-33
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 37 516 2.0E-31
sp|P98080|UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans GN=ucr-1 PE=3 SV=2 46 533 6.0E-31
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 46 520 2.0E-30
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 30 520 4.0E-30
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 28 503 9.0E-30
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 36 503 3.0E-29
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 53 503 5.0E-13
sp|Q5UPX9|YL233_MIMIV Putative zinc protease L233 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L233 PE=3 SV=1 50 232 1.0E-11
sp|P07256|QCR1_YEAST Cytochrome b-c1 complex subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COR1 PE=1 SV=1 46 496 2.0E-11
sp|Q6FSJ3|QCR2_CANGA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR2 PE=3 SV=1 56 251 2.0E-10
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 53 268 3.0E-08
sp|P07257|QCR2_YEAST Cytochrome b-c1 complex subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR2 PE=1 SV=1 54 199 1.0E-07
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 70 249 2.0E-07
sp|Q6CWJ6|QCR2_KLULA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR2 PE=3 SV=1 63 235 2.0E-07
sp|P45181|PQQL_HAEIN Probable zinc protease PqqL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pqqL PE=3 SV=1 49 251 3.0E-07
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 53 196 3.0E-06
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 54 234 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5684
MLRQLGARLRPNLTAPAFRGALGYGRRRMATVQVEGIPKEPTELDKVTRLSNGLRVASEALPGSFSAVGVFVEAG
SRFEDEGLRGVSHLVDRLAFKSTPRHTADEMMERVEALGGNIHCSSSRESMMYQAATFNSAVPETVALLAETIRD
AHISESEVAEQIETARYEIAEIWDKPELILPELVHTAAFKDNTLGNPLLCPEDRLAHIDRRTVVAYRHRFYKPDR
MVLAFAGVDHETAVKLAEQYFGDMTPSAGYEAVSDSVSAAQQRSRSTSKIPLIKNLSTSAAREATVLDALPPSTA
RQTGAAHYTGGYLAMPAQQPSLNKGKHTHIHLAFEGLPVGSDDIYALATLQTLLGGGGSFSAGGPGKGMYSRLFT
NVLNQHGWIESCVAFNHTYTDSGLFGISASCTPGQTSMMIDVMCHELRSLTLKHGHGTLTAEEVARAKNQLRSSL
LMNLESRMVELEDLGRSVQVHGYKLPVRDVCRRIQALTVDDLRRVADMVVNGRVANRGGGSGAPTVVVQEARDYG
VTSHGMSWDQIQDRIDRWQIGRRA
Coding >Ophio5|5684
ATGTTGCGACAACTCGGCGCCCGGCTACGGCCGAATCTGACGGCGCCGGCCTTTCGCGGGGCGCTGGGGTATGGG
AGGAGGAGAATGGCGACGGTCCAGGTGGAGGGCATCCCCAAGGAACCCACAGAACTCGACAAGGTGACGAGACTG
TCCAACGGTCTGCGCGTCGCCTCCGAGGCCCTACCCGGCTCCTTCTCCGCCGTCGGCGTCTTCGTCGAGGCCGGA
TCGCGATTCGAAGACGAGGGGCTCCGGGGTGTTTCCCACCTGGTCGATCGACTGGCGTTCAAGTCGACGCCACGA
CATACGGCAGACGAGATGATGGAGCGGGTCGAGGCGCTCGGGGGAAACATCCACTGCTCGTCGTCGCGCGAATCC
ATGATGTACCAGGCGGCCACGTTCAACAGCGCCGTGCCGGAAACGGTGGCCCTACTGGCCGAGACGATTCGCGAC
GCGCACATCTCCGAGTCCGAGGTGGCGGAACAGATTGAGACGGCGCGATACGAGATTGCCGAGATTTGGGATAAG
CCCGAACTCATCCTGCCAGAGCTGGTCCATACGGCTGCTTTCAAGGATAACACGCTGGGGAATCCGCTGCTGTGT
CCGGAGGATCGGCTGGCGCACATCGATCGTCGTACCGTGGTCGCCTATCGCCATCGCTTCTATAAGCCGGATCGG
ATGGTGCTGGCCTTTGCCGGCGTCGACCACGAGACGGCTGTCAAGTTGGCCGAGCAATACTTTGGCGACATGACG
CCGTCGGCGGGGTATGAAGCCGTGTCCGATTCCGTCTCGGCCGCTCAGCAGCGTTCGAGGTCGACATCCAAGATA
CCCCTGATCAAGAACCTGTCGACCTCGGCAGCGCGCGAAGCCACCGTCCTCGACGCCCTCCCCCCCTCTACGGCC
AGACAAACCGGTGCGGCGCATTACACAGGCGGCTACCTCGCCATGCCGGCGCAGCAGCCATCCCTCAACAAGGGG
AAACACACGCACATCCACCTGGCCTTCGAGGGCCTGCCCGTCGGATCCGACGACATCTACGCTCTCGCCACCTTA
CAGACGCTTCTCGGCGGCGGGGGCTCATTTTCCGCCGGCGGACCCGGCAAGGGCATGTACTCTCGCCTCTTCACC
AACGTCCTGAATCAACACGGCTGGATCGAGTCGTGCGTAGCCTTCAACCACACCTACACGGACTCGGGACTCTTT
GGCATATCGGCATCATGCACGCCGGGTCAGACTTCCATGATGATCGACGTAATGTGTCACGAGCTACGATCCTTG
ACCCTCAAGCACGGGCACGGCACCCTCACGGCGGAGGAGGTGGCACGAGCCAAGAACCAACTACGCAGCAGTCTC
CTGATGAACCTCGAGAGTCGCATGGTCGAGCTCGAGGACCTGGGCCGTTCGGTCCAAGTGCATGGATACAAGTTG
CCGGTCAGGGACGTCTGTCGACGCATTCAGGCGCTTACGGTCGACGATCTGAGGCGGGTGGCCGACATGGTGGTT
AATGGGCGGGTTGCGAACAGGGGGGGTGGCAGTGGTGCGCCGACGGTGGTTGTGCAGGAGGCGAGGGATTATGGC
GTTACGAGCCATGGCATGTCGTGGGATCAGATCCAGGATCGGATTGATCGCTGGCAGATTGGGAGGCGGGCT
Transcript >Ophio5|5684
ATGTTGCGACAACTCGGCGCCCGGCTACGGCCGAATCTGACGGCGCCGGCCTTTCGCGGGGCGCTGGGGTATGGG
AGGAGGAGAATGGCGACGGTCCAGGTGGAGGGCATCCCCAAGGAACCCACAGAACTCGACAAGGTGACGAGACTG
TCCAACGGTCTGCGCGTCGCCTCCGAGGCCCTACCCGGCTCCTTCTCCGCCGTCGGCGTCTTCGTCGAGGCCGGA
TCGCGATTCGAAGACGAGGGGCTCCGGGGTGTTTCCCACCTGGTCGATCGACTGGCGTTCAAGTCGACGCCACGA
CATACGGCAGACGAGATGATGGAGCGGGTCGAGGCGCTCGGGGGAAACATCCACTGCTCGTCGTCGCGCGAATCC
ATGATGTACCAGGCGGCCACGTTCAACAGCGCCGTGCCGGAAACGGTGGCCCTACTGGCCGAGACGATTCGCGAC
GCGCACATCTCCGAGTCCGAGGTGGCGGAACAGATTGAGACGGCGCGATACGAGATTGCCGAGATTTGGGATAAG
CCCGAACTCATCCTGCCAGAGCTGGTCCATACGGCTGCTTTCAAGGATAACACGCTGGGGAATCCGCTGCTGTGT
CCGGAGGATCGGCTGGCGCACATCGATCGTCGTACCGTGGTCGCCTATCGCCATCGCTTCTATAAGCCGGATCGG
ATGGTGCTGGCCTTTGCCGGCGTCGACCACGAGACGGCTGTCAAGTTGGCCGAGCAATACTTTGGCGACATGACG
CCGTCGGCGGGGTATGAAGCCGTGTCCGATTCCGTCTCGGCCGCTCAGCAGCGTTCGAGGTCGACATCCAAGATA
CCCCTGATCAAGAACCTGTCGACCTCGGCAGCGCGCGAAGCCACCGTCCTCGACGCCCTCCCCCCCTCTACGGCC
AGACAAACCGGTGCGGCGCATTACACAGGCGGCTACCTCGCCATGCCGGCGCAGCAGCCATCCCTCAACAAGGGG
AAACACACGCACATCCACCTGGCCTTCGAGGGCCTGCCCGTCGGATCCGACGACATCTACGCTCTCGCCACCTTA
CAGACGCTTCTCGGCGGCGGGGGCTCATTTTCCGCCGGCGGACCCGGCAAGGGCATGTACTCTCGCCTCTTCACC
AACGTCCTGAATCAACACGGCTGGATCGAGTCGTGCGTAGCCTTCAACCACACCTACACGGACTCGGGACTCTTT
GGCATATCGGCATCATGCACGCCGGGTCAGACTTCCATGATGATCGACGTAATGTGTCACGAGCTACGATCCTTG
ACCCTCAAGCACGGGCACGGCACCCTCACGGCGGAGGAGGTGGCACGAGCCAAGAACCAACTACGCAGCAGTCTC
CTGATGAACCTCGAGAGTCGCATGGTCGAGCTCGAGGACCTGGGCCGTTCGGTCCAAGTGCATGGATACAAGTTG
CCGGTCAGGGACGTCTGTCGACGCATTCAGGCGCTTACGGTCGACGATCTGAGGCGGGTGGCCGACATGGTGGTT
AATGGGCGGGTTGCGAACAGGGGGGGTGGCAGTGGTGCGCCGACGGTGGTTGTGCAGGAGGCGAGGGATTATGGC
GTTACGAGCCATGGCATGTCGTGGGATCAGATCCAGGATCGGATTGATCGCTGGCAGATTGGGAGGCGGGCTTGA
Gene >Ophio5|5684
ATGTTGCGACAACTCGGCGCCCGGCTACGGCCGAATCTGACGGCGCCGGCCTTTCGCGGGGCGCTGGGGTATGGG
AGGAGGAGAATGGCGACGGTCCAGGTGGAGGGCATCCCCAAGGTAAGCAAGGCTTGTCGCAACGAAAAGAGAAGA
GAAGAGAAGCGTATCGCTAACCATGGCATCAGGAACCCACAGAACTCGACAAGGTGACGAGACTGTCCAACGGTC
TGCGCGTCGCCTCCGAGGCCCTACCCGGCTCCTTCTCCGCCGTCGGCGTCTTCGTCGAGGCCGGATCGCGATTCG
AAGACGAGGGGCTCCGGGGTGTTTCCCACCTGGTCGATCGACTGGCGTTCAAGTCGACGCCACGACATACGGCAG
ACGAGATGATGGAGCGGGTCGAGGCGCTCGGGGGAAACATCCACTGCTCGTCGTCGCGCGAATCCATGATGTACC
AGGCGGCCACGTTCAACAGCGCCGTGCCGGAAACGGTGGCCCTACTGGCCGAGACGATTCGCGACGCGCACATCT
CCGAGTCCGAGGTGGCGGAACAGATTGAGACGGCGCGATACGAGATTGCCGAGATTTGGGATAAGCCCGAACTCA
TCCTGCCAGAGCTGGTCCATACGGCTGCTTTCAAGGATAACACGCTGGGGAATCCGCTGCTGTGTCCGGAGGATC
GGCTGGCGCACATCGATCGTCGTACCGTGGTCGCCTATCGCCATCGCTTCTATAAGCCGGATCGGATGGTGCTGG
CCTTTGCCGGCGTCGACCACGAGACGGCTGTCAAGTTGGCCGAGCAATACTTTGGCGACATGACGCCGTCGGCGG
GGTATGAAGCCGTGTCCGATTCCGTCTCGGCCGCTCAGCAGCGTTCGAGGTCGACATCCAAGATACCCCTGATCA
AGAACCTGTCGACCTCGGCAGCGCGCGAAGCCACCGTCCTCGACGCCCTCCCCCCCTCTACGGCCAGACAAACCG
GTGCGGCGCATTACACAGGCGGCTACCTCGCCATGCCGGCGCAGCAGCCATCCCTCAACAAGGGGAAACACACGC
ACATCCACCTGGCCTTCGAGGGCCTGCCCGTCGGATCCGACGACATCTACGCTCTCGCCACCTTACAGACGCTTC
TCGGCGGCGGGGGCTCATTTTCCGCCGGCGGACCCGGCAAGGGCATGTACTCTCGCCTCTTCACCAACGTCCTGA
ATCAACACGGCTGGATCGAGTCGTGCGTAGCCTTCAACCACACCTACACGGACTCGGGACTCTTTGGCATATCGG
CATCATGCACGCCGGGTCAGACTTCCATGATGATCGACGTAATGTGTCACGAGCTACGATCCTTGACCCTCAAGC
ACGGGCACGGCACCCTCACGGCGGAGGAGGTGGCACGAGCCAAGAACCAACTACGCAGCAGTCTCCTGATGAACC
TCGAGAGTCGCATGGTCGAGCTCGAGGACCTGGGCCGTTCGGTCCAAGTGCATGGATACAAGTTGCCGGTCAGGG
ACGTCTGTCGACGCATTCAGGCGCTTACGGTCGACGATCTGAGGCGGGTGGCCGACATGGTGGTTAATGGGCGGG
TTGCGAACAGGGGGGGTGGCAGTGGTGCGCCGACGGTGGTTGTGCAGGAGGCGAGGGATTATGGCGTTACGAGCC
ATGGCATGTCGTGGGATCAGATCCAGGATCGGATTGATCGCTGGCAGATTGGGAGGCGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail