Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5667
Gene name
Locationscaffold_47:31219..34359
Strand+
Gene length (bp)3140
Transcript length (bp)3021
Coding sequence length (bp)3018
Protein length (aa) 1006

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 145.92 66.88 224.95
CcL In ants, during behavior modification 217.28 0.00 467.34
CcD In ants, recently dead 220.08 89.53 350.63

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.332188 no
SC16a CcD 0.142774 no
CcL CcD 0.977571 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5667
MLSRISVAIVAAAGAVQALPAPEHTVQNSTAAAGNGSYAVPTRTHTIRETHIHTFKPESAKFTNFNDDDGGACDD
AFLLDQDVLQSPVTSPFSSPSAGYGYNRFGFQYEQTATFAVNGPIATLAPNVHWDFDTKPAANVRPIMPGTGSEL
YYGHGDPEKSGRFAFLTYYFTSPSVNLDHSDHVKVVSYEAHTSASATMIVRFTSQEAFGHAERTWSVKNGLILIS
YVRGCGDYDKGDRCYFKATSLEKHTVDGRLEMTVKGEIKLPETIITGGETEWGVWIPRKNDRNRGNPSPSASDAA
SFSWAPTTSSSARPSYTPFPTFTTAVSPSPTAPTNRTQSLGRDQDANSCHPPVDTKYGLPTACLGDYFDQDLDNL
MGYEGINAADEQFLRQLYPVFDQEADPTTPGFDFRPHDPVWKKHRRSVRLEKRLWPFSQIWKAIKRLIQLSASIN
KEFSWQLPSPEQVDKIQDEHAKQVESPWGDAILLKSYSSGESEEEREAKYLHVYCVGCGVKGQARINGRASWGIG
DGITEAKVDFHTDMEFVLKLGIDARISYAKEFETELLEVGLPGLQYGPVTFGPWISLGAKVKLEAAAKGRLLAGA
EMGLHDAHIVIDYKATEPVQSGWEPYFKPVLEANGALMISAELGLPMALKAGLKIASFERAAKLVDEPSVKAVAQ
VAASVALNHTAPFSAGFDETDGCGGILTRIAWRNKLWADAFGLKTYNLFDTDDRTLAPVCIPLPPRVQQKVPLLM
AEPTFQNSSGRLDAQNLARHSGPIRDQTRPLLQSLPGGFSDELSYSVTGVQDMSYNNTHGVEYGRLVDHDETTMV
ASCSNGNMYAVVAERTENNTACSALWAATADNTMLMDGASRIMHYGTESMAKAGVSRIRLGPADELHRSSRLVVW
TVEYNPDAPEGMRRYYLVRNADGDVFYPLVCEYSNGEGAKVFLAKDPDEGVKTLESDDVAYSITGGYVSSCHGLL
LLQEEHDHDKDPVFYSISGGEDEFSEYTRIV
Coding >Ophio5|5667
ATGCTTTCAAGAATATCCGTCGCCATCGTGGCGGCCGCTGGAGCTGTCCAGGCATTGCCCGCCCCTGAACATACC
GTCCAGAACTCAACAGCAGCTGCAGGCAATGGCAGCTACGCTGTCCCGACCCGCACACATACCATTCGGGAGACT
CATATTCACACATTCAAACCTGAGTCTGCCAAGTTCACTAACTTCAACGACGACGACGGCGGGGCTTGTGATGAT
GCCTTCCTGTTGGACCAAGATGTCCTCCAGTCCCCGGTGACATCTCCATTTTCCTCGCCTTCCGCCGGCTATGGC
TACAATCGATTCGGTTTCCAGTACGAACAGACGGCTACGTTCGCCGTCAACGGTCCAATTGCCACGCTTGCGCCA
AATGTTCACTGGGACTTTGATACCAAGCCTGCGGCCAACGTGAGGCCCATCATGCCTGGCACTGGCTCGGAGCTG
TACTACGGCCACGGCGATCCGGAAAAGTCGGGCCGATTCGCCTTCCTCACCTACTACTTCACCAGCCCTTCAGTC
AACCTCGACCACTCGGACCATGTCAAGGTCGTCAGCTACGAGGCTCACACGTCAGCGTCTGCCACCATGATAGTC
AGGTTCACGAGCCAGGAGGCTTTTGGGCACGCCGAGAGAACCTGGTCGGTAAAGAATGGACTGATTCTCATCAGC
TATGTCCGGGGCTGTGGCGATTACGACAAGGGAGACCGATGCTACTTCAAGGCCACGAGCTTGGAGAAGCATACG
GTCGACGGCAGGTTGGAGATGACGGTCAAGGGCGAGATCAAGCTACCAGAGACGATAATTACTGGCGGCGAGACG
GAATGGGGTGTGTGGATTCCTCGCAAGAACGATCGGAATCGGGGGAACCCTTCACCATCGGCGAGTGACGCCGCC
AGCTTCTCCTGGGCTCCAACCACCAGCTCGAGTGCCAGGCCCAGCTACACGCCTTTTCCAACCTTCACCACGGCC
GTCTCTCCTTCACCTACCGCACCCACCAATCGCACCCAATCATTGGGCCGTGACCAAGACGCAAACAGCTGCCAC
CCGCCCGTCGACACCAAGTACGGTCTCCCTACAGCCTGCCTAGGCGATTACTTTGACCAGGATCTTGACAACCTC
ATGGGCTACGAGGGAATAAACGCCGCCGACGAGCAATTCCTGAGACAGCTGTATCCCGTGTTCGACCAAGAGGCC
GATCCAACAACGCCAGGGTTCGACTTTCGTCCGCACGATCCGGTGTGGAAAAAGCACCGTCGATCGGTGAGGCTG
GAGAAGAGACTCTGGCCCTTCAGCCAAATCTGGAAGGCGATTAAGAGACTGATTCAGCTCTCGGCCAGTATCAAC
AAGGAGTTTTCGTGGCAACTCCCCAGCCCCGAACAAGTCGACAAGATCCAAGATGAGCACGCCAAGCAAGTCGAG
TCGCCTTGGGGAGACGCCATCCTCCTCAAGTCGTACAGCTCCGGAGAATCCGAGGAGGAGCGAGAGGCCAAGTAT
CTCCATGTCTACTGCGTCGGCTGCGGCGTCAAGGGACAAGCCAGGATCAACGGCCGGGCCTCGTGGGGTATAGGG
GATGGCATCACCGAGGCCAAGGTCGATTTCCACACTGACATGGAGTTTGTTCTCAAACTCGGCATTGATGCCAGG
ATATCGTACGCAAAGGAGTTTGAGACGGAACTGCTGGAAGTTGGTCTGCCGGGCTTGCAATACGGTCCCGTCACC
TTCGGCCCCTGGATTTCTCTCGGCGCCAAGGTGAAGCTCGAGGCGGCAGCTAAGGGCAGGCTGCTGGCGGGCGCC
GAAATGGGACTGCACGACGCCCATATCGTCATCGACTACAAAGCCACAGAGCCCGTCCAGAGCGGCTGGGAGCCC
TACTTCAAGCCCGTCCTCGAGGCCAACGGAGCCCTCATGATCTCCGCCGAGCTGGGTCTGCCCATGGCCCTCAAG
GCCGGCTTGAAGATTGCATCGTTTGAGAGAGCGGCCAAGCTGGTCGACGAACCGTCCGTCAAGGCAGTTGCCCAG
GTCGCCGCCTCCGTCGCTCTCAATCATACCGCACCCTTCTCCGCCGGTTTCGACGAGACGGACGGCTGTGGAGGC
ATTCTCACCCGGATCGCCTGGCGCAATAAGCTGTGGGCTGACGCCTTCGGCTTGAAAACGTACAACCTCTTCGAC
ACCGACGACAGGACACTGGCCCCCGTCTGCATTCCGTTGCCCCCTCGAGTCCAGCAAAAGGTCCCGTTATTGATG
GCCGAGCCGACATTTCAAAACAGCTCGGGGCGTCTCGATGCCCAGAACCTGGCCAGACACTCTGGGCCCATTCGC
GATCAAACAAGGCCCCTGCTGCAGTCTTTGCCGGGAGGCTTCTCTGACGAGCTCTCCTATAGCGTGACCGGAGTC
CAAGACATGTCGTACAATAACACGCACGGGGTGGAATATGGCCGCCTGGTAGATCACGACGAGACGACAATGGTG
GCATCCTGCAGCAACGGCAACATGTACGCTGTCGTCGCAGAGCGCACCGAGAATAACACGGCATGCTCTGCTCTG
TGGGCAGCAACCGCCGACAACACGATGCTTATGGACGGCGCCTCCAGGATCATGCATTATGGCACCGAGTCCATG
GCCAAGGCTGGCGTGTCACGCATTCGTCTCGGTCCCGCCGACGAGCTGCACAGGTCTAGCCGACTGGTTGTCTGG
ACCGTCGAGTACAACCCCGATGCTCCCGAGGGCATGAGACGCTACTACCTGGTGAGAAACGCGGACGGTGATGTC
TTCTATCCCCTCGTGTGCGAGTACAGCAACGGGGAGGGCGCCAAGGTCTTCCTGGCTAAGGACCCCGACGAGGGT
GTTAAGACGCTGGAGAGCGACGACGTGGCCTACTCCATCACAGGTGGCTATGTTTCGAGCTGCCATGGCCTGCTG
CTTCTTCAGGAGGAACATGACCATGACAAAGACCCGGTCTTCTACTCCATCAGTGGAGGAGAGGATGAATTCTCC
GAGTATACGAGAATAGTG
Transcript >Ophio5|5667
ATGCTTTCAAGAATATCCGTCGCCATCGTGGCGGCCGCTGGAGCTGTCCAGGCATTGCCCGCCCCTGAACATACC
GTCCAGAACTCAACAGCAGCTGCAGGCAATGGCAGCTACGCTGTCCCGACCCGCACACATACCATTCGGGAGACT
CATATTCACACATTCAAACCTGAGTCTGCCAAGTTCACTAACTTCAACGACGACGACGGCGGGGCTTGTGATGAT
GCCTTCCTGTTGGACCAAGATGTCCTCCAGTCCCCGGTGACATCTCCATTTTCCTCGCCTTCCGCCGGCTATGGC
TACAATCGATTCGGTTTCCAGTACGAACAGACGGCTACGTTCGCCGTCAACGGTCCAATTGCCACGCTTGCGCCA
AATGTTCACTGGGACTTTGATACCAAGCCTGCGGCCAACGTGAGGCCCATCATGCCTGGCACTGGCTCGGAGCTG
TACTACGGCCACGGCGATCCGGAAAAGTCGGGCCGATTCGCCTTCCTCACCTACTACTTCACCAGCCCTTCAGTC
AACCTCGACCACTCGGACCATGTCAAGGTCGTCAGCTACGAGGCTCACACGTCAGCGTCTGCCACCATGATAGTC
AGGTTCACGAGCCAGGAGGCTTTTGGGCACGCCGAGAGAACCTGGTCGGTAAAGAATGGACTGATTCTCATCAGC
TATGTCCGGGGCTGTGGCGATTACGACAAGGGAGACCGATGCTACTTCAAGGCCACGAGCTTGGAGAAGCATACG
GTCGACGGCAGGTTGGAGATGACGGTCAAGGGCGAGATCAAGCTACCAGAGACGATAATTACTGGCGGCGAGACG
GAATGGGGTGTGTGGATTCCTCGCAAGAACGATCGGAATCGGGGGAACCCTTCACCATCGGCGAGTGACGCCGCC
AGCTTCTCCTGGGCTCCAACCACCAGCTCGAGTGCCAGGCCCAGCTACACGCCTTTTCCAACCTTCACCACGGCC
GTCTCTCCTTCACCTACCGCACCCACCAATCGCACCCAATCATTGGGCCGTGACCAAGACGCAAACAGCTGCCAC
CCGCCCGTCGACACCAAGTACGGTCTCCCTACAGCCTGCCTAGGCGATTACTTTGACCAGGATCTTGACAACCTC
ATGGGCTACGAGGGAATAAACGCCGCCGACGAGCAATTCCTGAGACAGCTGTATCCCGTGTTCGACCAAGAGGCC
GATCCAACAACGCCAGGGTTCGACTTTCGTCCGCACGATCCGGTGTGGAAAAAGCACCGTCGATCGGTGAGGCTG
GAGAAGAGACTCTGGCCCTTCAGCCAAATCTGGAAGGCGATTAAGAGACTGATTCAGCTCTCGGCCAGTATCAAC
AAGGAGTTTTCGTGGCAACTCCCCAGCCCCGAACAAGTCGACAAGATCCAAGATGAGCACGCCAAGCAAGTCGAG
TCGCCTTGGGGAGACGCCATCCTCCTCAAGTCGTACAGCTCCGGAGAATCCGAGGAGGAGCGAGAGGCCAAGTAT
CTCCATGTCTACTGCGTCGGCTGCGGCGTCAAGGGACAAGCCAGGATCAACGGCCGGGCCTCGTGGGGTATAGGG
GATGGCATCACCGAGGCCAAGGTCGATTTCCACACTGACATGGAGTTTGTTCTCAAACTCGGCATTGATGCCAGG
ATATCGTACGCAAAGGAGTTTGAGACGGAACTGCTGGAAGTTGGTCTGCCGGGCTTGCAATACGGTCCCGTCACC
TTCGGCCCCTGGATTTCTCTCGGCGCCAAGGTGAAGCTCGAGGCGGCAGCTAAGGGCAGGCTGCTGGCGGGCGCC
GAAATGGGACTGCACGACGCCCATATCGTCATCGACTACAAAGCCACAGAGCCCGTCCAGAGCGGCTGGGAGCCC
TACTTCAAGCCCGTCCTCGAGGCCAACGGAGCCCTCATGATCTCCGCCGAGCTGGGTCTGCCCATGGCCCTCAAG
GCCGGCTTGAAGATTGCATCGTTTGAGAGAGCGGCCAAGCTGGTCGACGAACCGTCCGTCAAGGCAGTTGCCCAG
GTCGCCGCCTCCGTCGCTCTCAATCATACCGCACCCTTCTCCGCCGGTTTCGACGAGACGGACGGCTGTGGAGGC
ATTCTCACCCGGATCGCCTGGCGCAATAAGCTGTGGGCTGACGCCTTCGGCTTGAAAACGTACAACCTCTTCGAC
ACCGACGACAGGACACTGGCCCCCGTCTGCATTCCGTTGCCCCCTCGAGTCCAGCAAAAGGTCCCGTTATTGATG
GCCGAGCCGACATTTCAAAACAGCTCGGGGCGTCTCGATGCCCAGAACCTGGCCAGACACTCTGGGCCCATTCGC
GATCAAACAAGGCCCCTGCTGCAGTCTTTGCCGGGAGGCTTCTCTGACGAGCTCTCCTATAGCGTGACCGGAGTC
CAAGACATGTCGTACAATAACACGCACGGGGTGGAATATGGCCGCCTGGTAGATCACGACGAGACGACAATGGTG
GCATCCTGCAGCAACGGCAACATGTACGCTGTCGTCGCAGAGCGCACCGAGAATAACACGGCATGCTCTGCTCTG
TGGGCAGCAACCGCCGACAACACGATGCTTATGGACGGCGCCTCCAGGATCATGCATTATGGCACCGAGTCCATG
GCCAAGGCTGGCGTGTCACGCATTCGTCTCGGTCCCGCCGACGAGCTGCACAGGTCTAGCCGACTGGTTGTCTGG
ACCGTCGAGTACAACCCCGATGCTCCCGAGGGCATGAGACGCTACTACCTGGTGAGAAACGCGGACGGTGATGTC
TTCTATCCCCTCGTGTGCGAGTACAGCAACGGGGAGGGCGCCAAGGTCTTCCTGGCTAAGGACCCCGACGAGGGT
GTTAAGACGCTGGAGAGCGACGACGTGGCCTACTCCATCACAGGTGGCTATGTTTCGAGCTGCCATGGCCTGCTG
CTTCTTCAGGAGGAACATGACCATGACAAAGACCCGGTCTTCTACTCCATCAGTGGAGGAGAGGATGAATTCTCC
GAGTATACGAGAATAGTGTGA
Gene >Ophio5|5667
ATGCTTTCAAGAATATCCGTCGCCATCGTGGCGGCCGCTGGAGCTGTCCAGGCATTGCCCGCCCCTGAACATACC
GTCCAGAACTCAACAGCAGCTGCAGGCAATGGCAGCTACGCTGTCCCGACCCGCACACATACCATTCGGGAGACT
CATATTCACACATTCAAACCTGAGTCTGCCAAGTTCACTAACTTCAACGACGACGACGGCGGGGCTTGTGATGAT
GCCTTCCTGTTGGACCAAGATGTCCTCCAGTCCCCGGTGACATCTCCATTTTCCTCGCCTTCCGCCGGCTATGGC
TACAATCGATTCGGTTTCCAGTACGAACAGACGGCTACGTTCGCCGTCAACGGTCCAATTGCCACGCTTGCGCCA
AATGTTCACTGGGACTTTGATACCAAGCCTGCGGCCAACGTGAGGCCCATCATGCCTGGCACTGGCTCGGAGCTG
TACTACGGCCACGGCGGTACGCGCTCTCAGCCACTCTTCGTATGGGGACAGTAGCAAGTTGCTGAGAGCCTCGTG
AACAGATCCGGAAAAGTCGGGCCGATTCGCCTTCCTCACCTACTACTTCACCAGCCCTTCAGTCAACCTCGACCA
CTCGGACCATGTCAAGGTCGTCAGCTACGAGGCTCACACGTCAGCGTCTGCCACCATGATAGTCAGGTTCACGAG
CCAGGAGGCTTTTGGGCACGCCGAGAGAACCTGGTCGGTAAAGAATGGACTGATTCTCATCAGCTATGTCCGGGG
CTGTGGCGATTACGACAAGGGAGACCGATGCTACTTCAAGGCCACGAGCTTGGAGAAGCATACGGTCGACGGCAG
GTTGGAGATGACGGTCAAGGGCGAGATCAAGCTACCAGAGACGATAATTACTGGCGGCGAGACGGAATGGGGTGT
GTGGATTCCTCGCAAGAACGATCGGAATCGGGGGAACCCTTCACCATCGGCGAGTGACGCCGCCAGCTTCTCCTG
GGCTCCAACCACCAGCTCGAGTGCCAGGCCCAGCTACACGCCTTTTCCAACCTTCACCACGGCCGTCTCTCCTTC
ACCTACCGCACCCACCAATCGCACCCAATCATTGGGCCGTGACCAAGACGCAAACAGCTGCCACCCGCCCGTCGA
CACCAAGTACGGTCTCCCTACAGCCTGCCTAGGCGATTACTTTGACCAGGATCTTGACAACCTCATGGGCTACGA
GGGAATAAACGCCGCCGACGAGCAATTCCTGAGACAGCTGTATCCCGTGTTCGACCAAGAGGCCGATCCAACAAC
GCCAGGGTTCGACTTTCGTCCGCACGATCCGGTGTGGAAAAAGCACCGTCGATCGGTGAGGCTGGAGAAGAGACT
CTGGCCCTTCAGCCAAATCTGGAAGGCGATTAAGAGACTGATTCAGCTCTCGGCCAGTATCAACAAGGAGTTTTC
GTGGCAACTCCCCAGCCCCGAACAAGTCGACAAGATCCAAGATGAGCACGCCAAGCAAGTCGAGTCGCCTTGGGG
AGACGCCATCCTCCTCAAGTCGTACAGCTCCGGAGAATCCGAGGAGGAGCGAGAGGCCAAGTATCTCCATGTCTA
CTGCGTCGGCTGCGGCGTCAAGGGACAAGCCAGGATCAACGGCCGGGCCTCGTGGGGTATAGGGGATGGCATCAC
CGAGGCCAAGGTCGATTTCCACACTGACATGGAGTTTGTTCTCAAACTCGGCATTGATGCCAGGATATCGTACGC
AAAGGAGTTTGAGACGGAACTGCTGGAAGTTGGTCTGCCGGGCTTGCAATACGGTCCCGTCACCTTCGGCCCCTG
GATTTCTCTCGGCGCCAAGGTGAAGCTCGAGGCGGCAGCTAAGGGCAGGCTGCTGGCGGGCGCCGAAATGGGACT
GCACGACGCCCATATCGTCATCGACTACAAAGCCACAGAGCCCGTCCAGAGCGGCTGGGAGCCCTACTTCAAGCC
CGTCCTCGAGGCCAACGGAGCCCTCATGATCTCCGCCGAGCTGGGTCTGCCCATGGCCCTCAAGGCCGGCTTGAA
GATTGCATCGTTTGAGAGAGCGGCCAAGCTGGTCGACGAACCGTCCGTCAAGGCAGTTGCCCAGGTCGCCGCCTC
CGTCGCTCTCAATCATACCGCACCCTTCTCCGCCGGTTTCGACGAGACGGACGGCTGTGGAGGCATTCTCACCCG
GATCGCCTGGCGCAATAAGCTGTGGGCTGACGCCTTCGGCTTGAAAACGTACAACCTCTTCGACACCGACGACAG
GACACTGGCCCCCGTCTGCATTCCGTAAGTCGTCCTCTTCAGTGAGTTTGGAGCTGTCGAGCTAAGGAGATTTGA
TAAGGTTGCCCCCTCGAGTCCAGCAAAAGGTCCCGTTATTGATGGCCGAGCCGACATTTCAAAACAGCTCGGGGC
GTCTCGATGCCCAGAACCTGGCCAGACACTCTGGGCCCATTCGCGATCAAACAAGGCCCCTGCTGCAGTCTTTGC
CGGGAGGCTTCTCTGACGAGCTCTCCTATAGCGTGACCGGAGTCCAAGACATGTCGTACAATAACACGCACGGGG
TGGAATATGGCCGCCTGGTAGATCACGACGAGACGACAATGGTGGCATCCTGCAGCAACGGCAACATGTACGCTG
TCGTCGCAGAGCGCACCGAGAATAACACGGCATGCTCTGCTCTGTGGGCAGCAACCGCCGACAACACGATGCTTA
TGGACGGCGCCTCCAGGATCATGCATTATGGCACCGAGTCCATGGCCAAGGCTGGCGTGTCACGCATTCGTCTCG
GTCCCGCCGACGAGCTGCACAGGTCTAGCCGACTGGTTGTCTGGACCGTCGAGTACAACCCCGATGCTCCCGAGG
GCATGAGACGCTACTACCTGGTGAGAAACGCGGACGGTGATGTCTTCTATCCCCTCGTGTGCGAGTACAGCAACG
GGGAGGGCGCCAAGGTCTTCCTGGCTAAGGACCCCGACGAGGGTGTTAAGACGCTGGAGAGCGACGACGTGGCCT
ACTCCATCACAGGTGGCTATGTTTCGAGCTGCCATGGCCTGCTGCTTCTTCAGGAGGAACATGACCATGACAAAG
ACCCGGTCTTCTACTCCATCAGTGGAGGAGAGGATGAATTCTCCGAGTATACGAGAATAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail