Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5662
Gene name
Locationscaffold_47:12124..13118
Strand+
Gene length (bp)994
Transcript length (bp)804
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12351 Fig1 Ca2+ regulator and membrane fusion protein Fig1 3.7E-54 75 256

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 140 162 22
3 182 204 22
4 235 257 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5662
MPNFQVGWYRFIPFLGYHHVLMILIAVAIILLSLLLAGCSSSSPLIPDIFLLSLYYQHYEAVPDTAQVDYNVHTA
IENIAGSASLQARVGYFGICVNPDGGSWLCSNNATALAKEVSVDQDPLNLIWLAAQFKDMIVFPYLIIIAIIFAF
VCFIALATFPGWHEEEDSQGSERVVHPFPPRFVSQISLTIIFIASIFVLVSVLWQHTASVAASIIAQDFANGAVR
SGVGTSAMVLGWFAFTLLIIVTIGLIIMVLSIRVFNEYLTDN
Coding >Ophio5|5662
ATGCCCAACTTTCAGGTCGGCTGGTATCGGTTCATACCGTTTCTTGGCTACCATCATGTCTTGATGATATTGATT
GCCGTCGCAATCATATTGCTATCTCTCCTTCTCGCCGGCTGTTCTTCCTCCTCACCCCTCATCCCCGACATCTTC
CTTCTCTCGCTCTATTATCAGCACTACGAGGCCGTCCCCGACACAGCTCAGGTCGACTACAACGTCCACACGGCC
ATCGAAAACATCGCCGGAAGCGCCAGTCTGCAGGCCCGCGTCGGCTACTTTGGCATCTGCGTCAATCCCGATGGC
GGCTCCTGGCTTTGCAGCAATAATGCGACGGCGCTGGCCAAGGAGGTCTCGGTCGATCAGGATCCCCTCAATCTC
ATCTGGCTGGCCGCTCAGTTCAAGGACATGATTGTTTTTCCCTATCTCATCATCATCGCCATCATCTTCGCCTTC
GTCTGCTTCATCGCCCTCGCCACTTTCCCCGGTTGGCACGAGGAAGAAGACTCCCAAGGCTCCGAGCGCGTCGTA
CACCCATTCCCCCCCCGATTTGTCTCGCAGATCTCCCTGACCATCATCTTCATCGCCTCCATCTTCGTCCTCGTC
TCGGTTCTCTGGCAGCACACCGCCTCCGTTGCCGCCTCCATCATCGCCCAGGACTTTGCCAACGGCGCGGTCCGC
AGCGGTGTCGGTACTAGCGCCATGGTTTTGGGCTGGTTCGCCTTTACGCTACTCATCATCGTCACCATCGGCCTG
ATTATCATGGTCCTTAGCATTAGGGTGTTTAATGAGTACTTGACTGATAAC
Transcript >Ophio5|5662
ATGCCCAACTTTCAGGTCGGCTGGTATCGGTTCATACCGTTTCTTGGCTACCATCATGTCTTGATGATATTGATT
GCCGTCGCAATCATATTGCTATCTCTCCTTCTCGCCGGCTGTTCTTCCTCCTCACCCCTCATCCCCGACATCTTC
CTTCTCTCGCTCTATTATCAGCACTACGAGGCCGTCCCCGACACAGCTCAGGTCGACTACAACGTCCACACGGCC
ATCGAAAACATCGCCGGAAGCGCCAGTCTGCAGGCCCGCGTCGGCTACTTTGGCATCTGCGTCAATCCCGATGGC
GGCTCCTGGCTTTGCAGCAATAATGCGACGGCGCTGGCCAAGGAGGTCTCGGTCGATCAGGATCCCCTCAATCTC
ATCTGGCTGGCCGCTCAGTTCAAGGACATGATTGTTTTTCCCTATCTCATCATCATCGCCATCATCTTCGCCTTC
GTCTGCTTCATCGCCCTCGCCACTTTCCCCGGTTGGCACGAGGAAGAAGACTCCCAAGGCTCCGAGCGCGTCGTA
CACCCATTCCCCCCCCGATTTGTCTCGCAGATCTCCCTGACCATCATCTTCATCGCCTCCATCTTCGTCCTCGTC
TCGGTTCTCTGGCAGCACACCGCCTCCGTTGCCGCCTCCATCATCGCCCAGGACTTTGCCAACGGCGCGGTCCGC
AGCGGTGTCGGTACTAGCGCCATGGTTTTGGGCTGGTTCGCCTTTACGCTACTCATCATCGTCACCATCGGCCTG
ATTATCATGGTCCTTAGCATTAGGGTGTTTAATGAGTACTTGACTGATAACTAA
Gene >Ophio5|5662
ATGCCCAACTTTCAGGTCGGCTGGTATCGTACGTTTTTCCACGGTTTTCGTTTGCACTGGAATGCTCGAGCTCAT
CATCTTCCTCTACAGGGTTCATACCGTTTCTTGGCTACCATCATGTCTTGATGATATTGATTGCCGTCGCAATCA
TATTGCTATGTACGTGTTCCCCCAAGCACAAACCTACAGACCAAGAAACAACTGACTCCGAACCCTTCACCTTCA
GCTCTCCTTCTCGCCGGCTGTTCTTCCTCCTCACCCCTCATCCCCGACATCTTCCTTCTCTCGCTCTATTATCAG
CACTACGAGGCCGTCCCCGACACAGCTCAGGTCGACTACAACGTCCACACGGCCATCGAAAACATCGCCGGAAGC
GCCAGTCTGCAGGCCCGCGTCGGCTACTTTGGCATCTGCGTCAATCCCGATGGCGGCTCCTGGCTTTGCAGCAAT
AATGCGACGGCGCTGGCCAAGGAGGTCTCGGTCGATCAGGATCCCCTCAATCTCATCTGGCTGGCCGCTCAGTTC
AAGGACATGATTGTTTTTCCCTATCTCATGTGAGAACAGTTGTTTCCTTCCGTCTTATTTCGTCTCCTAACTGAC
ACAACCAACGTCCAGCATCATCGCCATCATCTTCGCCTTCGTCTGCTTCATCGCCCTCGCCACTTTCCCCGGTTG
GCACGAGGAAGAAGACTCCCAAGGCTCCGAGCGCGTCGTACACCCATTCCCCCCCCGATTTGTCTCGCAGATCTC
CCTGACCATCATCTTCATCGCCTCCATCTTCGTCCTCGTCTCGGTTCTCTGGCAGCACACCGCCTCCGTTGCCGC
CTCCATCATCGCCCAGGACTTTGCCAACGGCGCGGTCCGCAGCGGTGTCGGTACTAGCGCCATGGTTTTGGGCTG
GTTCGCCTTTACGCTACTCATCATCGTCACCATCGGCCTGATTATCATGGTCCTTAGCATTAGGGTGTTTAATGA
GTACTTGACTGATAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail