Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5653
Gene name
Locationscaffold_469:10525..12283
Strand+
Gene length (bp)1758
Transcript length (bp)1488
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 2.1E-131 30 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 22 405 2.0E-100
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 14 405 2.0E-97
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 1 402 1.0E-95
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 1 405 2.0E-95
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 1 401 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 22 405 2.0E-100
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 14 405 2.0E-97
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 1 402 1.0E-95
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 1 405 2.0E-95
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 1 401 4.0E-88
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 1 405 1.0E-81
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 65 397 7.0E-80
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 6 404 3.0E-74
sp|Q9P6I4|YHG6_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.06c PE=3 SV=1 4 395 6.0E-64
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.12 0.0756 0.5016 0.5662 0.0561 0.0397 0.2845 0.2663 0.2662 0.0223

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH76 6.2E-92 25 398

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|851
Ophiocordyceps australis 1348a (Ghana) OphauG2|5443
Ophiocordyceps australis 1348a (Ghana) OphauG2|4774
Ophiocordyceps australis 1348a (Ghana) OphauG2|4766
Ophiocordyceps australis 1348a (Ghana) OphauG2|1899
Ophiocordyceps australis map64 (Brazil) OphauB2|7760
Ophiocordyceps australis map64 (Brazil) OphauB2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|3901
Ophiocordyceps australis map64 (Brazil) OphauB2|3420
Ophiocordyceps australis map64 (Brazil) OphauB2|2008
Ophiocordyceps camponoti-floridani Ophcf2|00987
Ophiocordyceps camponoti-floridani Ophcf2|06598
Ophiocordyceps camponoti-floridani Ophcf2|06757
Ophiocordyceps camponoti-floridani Ophcf2|06881
Ophiocordyceps camponoti-floridani Ophcf2|03911
Ophiocordyceps camponoti-floridani Ophcf2|02543
Ophiocordyceps camponoti-rufipedis Ophun1|305
Ophiocordyceps camponoti-rufipedis Ophun1|3601
Ophiocordyceps camponoti-rufipedis Ophun1|4119
Ophiocordyceps camponoti-rufipedis Ophun1|5000
Ophiocordyceps camponoti-rufipedis Ophun1|6482
Ophiocordyceps camponoti-rufipedis Ophun1|5419
Ophiocordyceps kimflemingae Ophio5|3601
Ophiocordyceps kimflemingae Ophio5|3900
Ophiocordyceps kimflemingae Ophio5|5653 (this protein)
Ophiocordyceps kimflemingae Ophio5|7279
Ophiocordyceps kimflemingae Ophio5|8067
Ophiocordyceps kimflemingae Ophio5|971
Ophiocordyceps subramaniannii Hirsu2|9651
Ophiocordyceps subramaniannii Hirsu2|923
Ophiocordyceps subramaniannii Hirsu2|6764
Ophiocordyceps subramaniannii Hirsu2|3862
Ophiocordyceps subramaniannii Hirsu2|3585
Ophiocordyceps subramaniannii Hirsu2|266
Ophiocordyceps subramaniannii Hirsu2|2507
Ophiocordyceps subramaniannii Hirsu2|10632

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5653
MKFVKSVHAAAAFTGFFAPKELDTDNQTSIRLVASTLAHDTMVHYTGNGSQAKPVDVGNVPKPYYWWVAGALWGA
MLDYYHMTGDASYNDVVLQALTAPTNLGRGLDFMPAEHASEEGNDDLFFWGSAVMSAAERNFPQPDDKLPSWLDM
AINVFNSLISRWNTADCGGGMLWQIYASNPNGMTYKNSVSNGGLFQLAARLARATGNETYLHWAEQAWNWTAARG
LIDGENFHVYDGVDIRTSCAEVNHLSFTYTSGIFLYGAAVLANHTRDPVWADRASRLLDGTGWFFQPDKPGRGVM
YEAACETVDKCNNDMVTFKGYLSRFMWQATVMQPALRKRVDAFLLPTARAAAATCTGGKDGRQCGMRWYKGSFDD
RAGLGSQMCALETIQGLLVDESEAPFSGKDIRRVRDCPWRHHGPKEPPPGPTDEPPDDDDDDDDDDDDDDDEGET
EKQNENDARRLGLDDTVIRLVVSFVAGCAIGGLIRTTGIDWHLGR
Coding >Ophio5|5653
ATGAAGTTTGTCAAGAGCGTGCACGCGGCGGCGGCCTTTACCGGCTTCTTCGCGCCCAAGGAATTGGATACGGAC
AACCAGACCTCGATTCGACTTGTGGCTTCGACGCTCGCCCACGACACCATGGTTCACTACACGGGCAACGGCAGT
CAAGCTAAGCCTGTGGACGTGGGCAACGTACCTAAACCGTACTACTGGTGGGTGGCGGGCGCTCTTTGGGGCGCT
ATGCTCGACTACTACCACATGACGGGCGACGCAAGCTACAATGATGTGGTGCTACAGGCTCTGACGGCGCCGACG
AACCTCGGTCGCGGACTCGACTTTATGCCGGCCGAGCATGCGTCCGAGGAGGGTAACGATGATCTCTTCTTTTGG
GGCTCTGCCGTCATGTCGGCCGCCGAACGCAACTTTCCCCAGCCCGATGACAAGCTGCCGTCGTGGCTCGACATG
GCCATCAACGTCTTCAACTCGCTCATCAGCCGCTGGAACACGGCCGATTGCGGCGGCGGTATGTTGTGGCAGATC
TACGCCTCCAACCCCAACGGCATGACGTACAAGAACTCGGTCAGCAACGGCGGCCTGTTCCAGTTGGCGGCGCGA
CTGGCGAGGGCCACGGGCAATGAGACGTATCTGCACTGGGCCGAACAGGCCTGGAACTGGACCGCGGCCCGTGGC
TTGATCGATGGCGAAAACTTTCACGTCTACGATGGCGTCGACATCCGCACCAGCTGTGCCGAGGTCAATCACTTG
TCTTTTACCTATACCAGCGGCATCTTCCTCTACGGCGCCGCCGTCCTAGCCAACCACACGCGAGACCCGGTATGG
GCTGATCGTGCTTCACGCCTCCTCGACGGCACCGGCTGGTTCTTCCAGCCGGACAAGCCGGGACGCGGCGTCATG
TACGAGGCGGCGTGCGAGACGGTCGACAAGTGCAACAACGACATGGTGACCTTTAAAGGTTACCTGTCGCGCTTC
ATGTGGCAGGCCACGGTGATGCAACCAGCGCTTCGAAAGCGCGTCGACGCCTTCCTCTTACCCACGGCTCGCGCC
GCCGCCGCGACGTGTACCGGCGGCAAAGACGGTCGCCAGTGCGGTATGCGCTGGTACAAGGGATCCTTCGACGAC
AGGGCAGGCCTCGGTTCCCAGATGTGCGCACTCGAGACGATTCAGGGCCTTCTCGTCGACGAGAGCGAAGCTCCC
TTCAGCGGCAAGGATATCCGCCGAGTCCGAGACTGCCCCTGGCGCCATCACGGGCCAAAGGAGCCTCCGCCTGGG
CCGACTGATGAGCCCCCTGACGATGATGACGACGACGACGACGACGACGACGACGATGACGACGAAGGCGAGACC
GAAAAGCAGAACGAGAATGACGCTCGTCGGCTCGGCCTCGATGATACCGTTATACGGCTCGTTGTCAGCTTCGTC
GCCGGCTGCGCCATAGGGGGGCTGATTCGAACGACGGGCATTGATTGGCACCTCGGGCGG
Transcript >Ophio5|5653
ATGAAGTTTGTCAAGAGCGTGCACGCGGCGGCGGCCTTTACCGGCTTCTTCGCGCCCAAGGAATTGGATACGGAC
AACCAGACCTCGATTCGACTTGTGGCTTCGACGCTCGCCCACGACACCATGGTTCACTACACGGGCAACGGCAGT
CAAGCTAAGCCTGTGGACGTGGGCAACGTACCTAAACCGTACTACTGGTGGGTGGCGGGCGCTCTTTGGGGCGCT
ATGCTCGACTACTACCACATGACGGGCGACGCAAGCTACAATGATGTGGTGCTACAGGCTCTGACGGCGCCGACG
AACCTCGGTCGCGGACTCGACTTTATGCCGGCCGAGCATGCGTCCGAGGAGGGTAACGATGATCTCTTCTTTTGG
GGCTCTGCCGTCATGTCGGCCGCCGAACGCAACTTTCCCCAGCCCGATGACAAGCTGCCGTCGTGGCTCGACATG
GCCATCAACGTCTTCAACTCGCTCATCAGCCGCTGGAACACGGCCGATTGCGGCGGCGGTATGTTGTGGCAGATC
TACGCCTCCAACCCCAACGGCATGACGTACAAGAACTCGGTCAGCAACGGCGGCCTGTTCCAGTTGGCGGCGCGA
CTGGCGAGGGCCACGGGCAATGAGACGTATCTGCACTGGGCCGAACAGGCCTGGAACTGGACCGCGGCCCGTGGC
TTGATCGATGGCGAAAACTTTCACGTCTACGATGGCGTCGACATCCGCACCAGCTGTGCCGAGGTCAATCACTTG
TCTTTTACCTATACCAGCGGCATCTTCCTCTACGGCGCCGCCGTCCTAGCCAACCACACGCGAGACCCGGTATGG
GCTGATCGTGCTTCACGCCTCCTCGACGGCACCGGCTGGTTCTTCCAGCCGGACAAGCCGGGACGCGGCGTCATG
TACGAGGCGGCGTGCGAGACGGTCGACAAGTGCAACAACGACATGGTGACCTTTAAAGGTTACCTGTCGCGCTTC
ATGTGGCAGGCCACGGTGATGCAACCAGCGCTTCGAAAGCGCGTCGACGCCTTCCTCTTACCCACGGCTCGCGCC
GCCGCCGCGACGTGTACCGGCGGCAAAGACGGTCGCCAGTGCGGTATGCGCTGGTACAAGGGATCCTTCGACGAC
AGGGCAGGCCTCGGTTCCCAGATGTGCGCACTCGAGACGATTCAGGGCCTTCTCGTCGACGAGAGCGAAGCTCCC
TTCAGCGGCAAGGATATCCGCCGAGTCCGAGACTGCCCCTGGCGCCATCACGGGCCAAAGGAGCCTCCGCCTGGG
CCGACTGATGAGCCCCCTGACGATGATGACGACGACGACGACGACGACGACGACGATGACGACGAAGGCGAGACC
GAAAAGCAGAACGAGAATGACGCTCGTCGGCTCGGCCTCGATGATACCGTTATACGGCTCGTTGTCAGCTTCGTC
GCCGGCTGCGCCATAGGGGGGCTGATTCGAACGACGGGCATTGATTGGCACCTCGGGCGGTGA
Gene >Ophio5|5653
ATGAAGTTTGTCAAGAGCGTGCACGCGGCGGCGGCCTTTACCGGCTTCTTCGCGCCCAAGGAATTGGATACGGAC
AACCAGAGTGAGTTCGGGAGTTCTTTTTAAACCAAGAAGAATAAGGGCTGGCGTGCTGATGCGACTCATTGGTTA
GCCTCGATTCGACTTGTGGCTTCGACGCTCGCCCACGACACCATGGTTCACTACACGGGCAACGGCAGTCAAGCT
AAGCCTGTGGTGAGTGTCCTTGAAAAAAAAAACTGTCTTTCCTGATGGGCAATGTGCGGCTGACGCTCTCGCAGG
ACGTGGGCAACGTACCTAAACCGTACTACTGGTGGGTGGCGGGCGCTCTTTGGGGCGCTATGCTCGACTACTACC
ACATGACGGGCGACGCAAGCTACAATGATGTGGTGCTACAGGCTCTGACGGCGCCGACGAACCTCGGTCGCGGAC
TCGACTTTATGCCGGCCGAGCATGCGTCCGAGGAGGGTAACGATGATCTCTTCTTTTGGGGCTCTGCCGTCATGT
CGGCCGCCGAACGCAACTTTCCCCAGCCCGATGACAAGCTGCCGTCGTGGCTCGACATGGCCATCAACGTCTTCA
ACTCGCTCATCAGCCGCTGGAACACGGCCGATTGCGGCGGCGGTATGTTGTGGCAGATCTACGCCTCCAACCCCA
ACGGCATGACGTACAAGAACTCGGTCAGCAACGGCGGCCTGTTCCAGTTGGCGGCGCGACTGGCGAGGGCCACGG
GCAATGAGACGTATCTGCACTGGGCCGAACAGGCCTGGAACTGGACCGCGGCCCGTGGCTTGATCGATGGCGAAA
ACTTTCACGTCTACGATGGCGTCGACATCCGCACCAGCTGTGCCGAGGTCAATCACTTGTCTTTTACCTATACCA
GCGGCATCTTCCTCTACGGCGCCGCCGTCCTAGCCAACCACACGCGAGACCCGGTATGGGCTGATCGTGCTTCAC
GCCTCCTCGACGGCACCGGCTGGTTCTTCCAGCCGGACAAGCCGGGACGCGGCGTCATGTACGAGGCGGCGTGCG
AGACGGTCGACAAGTGCAACAACGACATGGTGACCTTTAAAGGTTACCTGTCGCGCTTCATGTGGCAGGCCACGG
TGATGCAACCAGCGCTTCGAAAGCGCGTCGACGCCTTCCTCTTACCCACGGCTCGCGCCGCCGCCGCGACGTGTA
CCGGCGGCAAAGACGGTCGCCAGTGCGGTATGCGCTGGTACAAGGGATCCTTCGACGACAGGGCAGGCCTCGGTT
CCCAGATGTGCGCACTCGAGACGATTCAGGGCCTTCTCGTCGACGAGAGCGAAGCTCCCTTCAGCGGCAAGGATA
TCCGCCGAGTCCGAGACTGCCCCTGGCGCCATCACGGGCCAAAGGTCAGCCGCTTCTGATCTTTGCTGAATTTTT
TTATTTTATTTTTATTTTCATCTTTTGGCTACGCCCGCCGCCCGCTCGCGCTCTAGGCTGAATGTGAGCTTCGTT
TGTCGTTGCCCTCGTCGGCCTGCTTTTTAGGAGCCTCCGCCTGGGCCGACTGATGAGCCCCCTGACGATGATGAC
GACGACGACGACGACGACGACGACGATGACGACGAAGGCGAGACCGAAAAGCAGAACGAGAATGACGCTCGTCGG
CTCGGCCTCGATGATACCGTTATACGGCTCGTTGTCAGCTTCGTCGCCGGCTGCGCCATAGGGGGGCTGATTCGA
ACGACGGGCATTGATTGGCACCTCGGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail