Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5651
Gene name
Locationscaffold_469:3726..5067
Strand-
Gene length (bp)1341
Transcript length (bp)1341
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 3.3E-08 38 82
PF01476 LysM LysM domain 3.2E-05 101 143
PF01476 LysM LysM domain 5.0E-03 155 181

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 22 194 3.0E-07
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 31 182 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5651
MASLMKSCLILLGGYSALAAAAPQDRPTAGSEPELCDHTVKLGEYCYLIAGTYGVNVTDLRRWNTQLDDDCSLKP
QDVLKVPCVQARAATPKMDGPCTKFYTTVEGDTCYSIATCEAVGPKNLIAWNKLDENCSLKVNQELCVSLYEPVK
CEKYHRVKKEDTCEKIAQKIGKDLSYLVGLNPALLFPDCFLDIGYKVCIEAESKAVPAVPEPAVSASASAEAAAP
AVVTTVPVPHWPLNRTATSFVTAIITKSSTSPAASSNAMASSPSNFTVNISQELMVRIRMILGRYVGNHTGSEPI
SDSVLLPPKTQVEEMIKEAAKVKSDSQGAGPVPGSNEVDAVSPPAAPASQSIVCNQIFNVFASTSVNIQNSGCAT
GTCSLQVSSNANAGFHWSPASSAYSAGNAPVAVGSQQQQNAAGVSASVKAEEEVDHILPPYEEEEGACEAE
Coding >Ophio5|5651
ATGGCCTCTCTCATGAAGAGCTGCCTTATTCTCCTCGGCGGCTACTCGGCCCTCGCCGCCGCCGCGCCGCAGGAC
CGGCCGACGGCGGGATCGGAACCCGAGCTGTGCGATCACACGGTCAAGCTCGGCGAATACTGCTATCTCATCGCC
GGGACATACGGCGTCAACGTCACGGACCTTCGCAGGTGGAACACGCAACTGGATGACGACTGCAGCCTCAAACCC
CAGGATGTTCTCAAGGTGCCCTGCGTCCAGGCGCGTGCGGCCACGCCGAAGATGGACGGCCCCTGCACCAAATTC
TACACCACAGTCGAGGGAGACACGTGCTACTCCATCGCTACCTGTGAGGCGGTCGGACCCAAGAACCTCATTGCC
TGGAACAAGCTCGATGAGAACTGCTCTCTCAAGGTCAATCAAGAGCTTTGCGTCTCTTTATACGAGCCTGTCAAG
TGTGAAAAGTATCATCGCGTCAAGAAGGAAGACACGTGCGAAAAGATCGCTCAGAAAATTGGCAAGGACCTGTCG
TACTTGGTTGGGCTGAACCCGGCGCTACTGTTCCCCGACTGCTTCCTTGATATTGGCTACAAGGTCTGCATCGAG
GCAGAGTCAAAGGCTGTTCCCGCCGTGCCCGAACCCGCCGTCTCCGCTTCCGCCTCCGCCGAGGCCGCTGCCCCG
GCGGTCGTCACCACCGTTCCGGTGCCCCATTGGCCCCTGAACAGGACCGCAACAAGCTTCGTCACAGCCATCATC
ACCAAGTCTTCCACCAGCCCGGCCGCCTCGTCCAACGCTATGGCCAGCAGCCCCTCTAATTTCACGGTCAACATT
TCCCAGGAGCTCATGGTCCGCATCAGGATGATCCTCGGCCGCTACGTCGGGAACCACACCGGGTCGGAGCCCATC
TCCGACTCGGTTCTTCTGCCGCCCAAAACCCAGGTCGAGGAGATGATCAAGGAGGCCGCCAAGGTCAAGTCTGAC
AGCCAAGGGGCAGGCCCAGTTCCCGGCAGCAACGAAGTCGATGCCGTTTCTCCGCCCGCTGCGCCCGCTTCCCAG
TCTATTGTTTGCAACCAGATTTTCAATGTCTTCGCGTCGACTTCGGTCAACATCCAAAACAGCGGCTGCGCTACC
GGCACCTGCTCCCTACAAGTTTCATCTAATGCTAATGCCGGCTTCCATTGGTCTCCGGCTTCCTCCGCGTACTCG
GCTGGCAACGCCCCGGTCGCGGTGGGCTCTCAGCAGCAGCAAAATGCTGCCGGTGTTTCGGCTTCTGTCAAGGCC
GAGGAGGAGGTTGACCACATTCTTCCGCCGTATGAGGAGGAAGAGGGGGCCTGTGAGGCCGAA
Transcript >Ophio5|5651
ATGGCCTCTCTCATGAAGAGCTGCCTTATTCTCCTCGGCGGCTACTCGGCCCTCGCCGCCGCCGCGCCGCAGGAC
CGGCCGACGGCGGGATCGGAACCCGAGCTGTGCGATCACACGGTCAAGCTCGGCGAATACTGCTATCTCATCGCC
GGGACATACGGCGTCAACGTCACGGACCTTCGCAGGTGGAACACGCAACTGGATGACGACTGCAGCCTCAAACCC
CAGGATGTTCTCAAGGTGCCCTGCGTCCAGGCGCGTGCGGCCACGCCGAAGATGGACGGCCCCTGCACCAAATTC
TACACCACAGTCGAGGGAGACACGTGCTACTCCATCGCTACCTGTGAGGCGGTCGGACCCAAGAACCTCATTGCC
TGGAACAAGCTCGATGAGAACTGCTCTCTCAAGGTCAATCAAGAGCTTTGCGTCTCTTTATACGAGCCTGTCAAG
TGTGAAAAGTATCATCGCGTCAAGAAGGAAGACACGTGCGAAAAGATCGCTCAGAAAATTGGCAAGGACCTGTCG
TACTTGGTTGGGCTGAACCCGGCGCTACTGTTCCCCGACTGCTTCCTTGATATTGGCTACAAGGTCTGCATCGAG
GCAGAGTCAAAGGCTGTTCCCGCCGTGCCCGAACCCGCCGTCTCCGCTTCCGCCTCCGCCGAGGCCGCTGCCCCG
GCGGTCGTCACCACCGTTCCGGTGCCCCATTGGCCCCTGAACAGGACCGCAACAAGCTTCGTCACAGCCATCATC
ACCAAGTCTTCCACCAGCCCGGCCGCCTCGTCCAACGCTATGGCCAGCAGCCCCTCTAATTTCACGGTCAACATT
TCCCAGGAGCTCATGGTCCGCATCAGGATGATCCTCGGCCGCTACGTCGGGAACCACACCGGGTCGGAGCCCATC
TCCGACTCGGTTCTTCTGCCGCCCAAAACCCAGGTCGAGGAGATGATCAAGGAGGCCGCCAAGGTCAAGTCTGAC
AGCCAAGGGGCAGGCCCAGTTCCCGGCAGCAACGAAGTCGATGCCGTTTCTCCGCCCGCTGCGCCCGCTTCCCAG
TCTATTGTTTGCAACCAGATTTTCAATGTCTTCGCGTCGACTTCGGTCAACATCCAAAACAGCGGCTGCGCTACC
GGCACCTGCTCCCTACAAGTTTCATCTAATGCTAATGCCGGCTTCCATTGGTCTCCGGCTTCCTCCGCGTACTCG
GCTGGCAACGCCCCGGTCGCGGTGGGCTCTCAGCAGCAGCAAAATGCTGCCGGTGTTTCGGCTTCTGTCAAGGCC
GAGGAGGAGGTTGACCACATTCTTCCGCCGTATGAGGAGGAAGAGGGGGCCTGTGAGGCCGAATAG
Gene >Ophio5|5651
ATGGCCTCTCTCATGAAGAGCTGCCTTATTCTCCTCGGCGGCTACTCGGCCCTCGCCGCCGCCGCGCCGCAGGAC
CGGCCGACGGCGGGATCGGAACCCGAGCTGTGCGATCACACGGTCAAGCTCGGCGAATACTGCTATCTCATCGCC
GGGACATACGGCGTCAACGTCACGGACCTTCGCAGGTGGAACACGCAACTGGATGACGACTGCAGCCTCAAACCC
CAGGATGTTCTCAAGGTGCCCTGCGTCCAGGCGCGTGCGGCCACGCCGAAGATGGACGGCCCCTGCACCAAATTC
TACACCACAGTCGAGGGAGACACGTGCTACTCCATCGCTACCTGTGAGGCGGTCGGACCCAAGAACCTCATTGCC
TGGAACAAGCTCGATGAGAACTGCTCTCTCAAGGTCAATCAAGAGCTTTGCGTCTCTTTATACGAGCCTGTCAAG
TGTGAAAAGTATCATCGCGTCAAGAAGGAAGACACGTGCGAAAAGATCGCTCAGAAAATTGGCAAGGACCTGTCG
TACTTGGTTGGGCTGAACCCGGCGCTACTGTTCCCCGACTGCTTCCTTGATATTGGCTACAAGGTCTGCATCGAG
GCAGAGTCAAAGGCTGTTCCCGCCGTGCCCGAACCCGCCGTCTCCGCTTCCGCCTCCGCCGAGGCCGCTGCCCCG
GCGGTCGTCACCACCGTTCCGGTGCCCCATTGGCCCCTGAACAGGACCGCAACAAGCTTCGTCACAGCCATCATC
ACCAAGTCTTCCACCAGCCCGGCCGCCTCGTCCAACGCTATGGCCAGCAGCCCCTCTAATTTCACGGTCAACATT
TCCCAGGAGCTCATGGTCCGCATCAGGATGATCCTCGGCCGCTACGTCGGGAACCACACCGGGTCGGAGCCCATC
TCCGACTCGGTTCTTCTGCCGCCCAAAACCCAGGTCGAGGAGATGATCAAGGAGGCCGCCAAGGTCAAGTCTGAC
AGCCAAGGGGCAGGCCCAGTTCCCGGCAGCAACGAAGTCGATGCCGTTTCTCCGCCCGCTGCGCCCGCTTCCCAG
TCTATTGTTTGCAACCAGATTTTCAATGTCTTCGCGTCGACTTCGGTCAACATCCAAAACAGCGGCTGCGCTACC
GGCACCTGCTCCCTACAAGTTTCATCTAATGCTAATGCCGGCTTCCATTGGTCTCCGGCTTCCTCCGCGTACTCG
GCTGGCAACGCCCCGGTCGCGGTGGGCTCTCAGCAGCAGCAAAATGCTGCCGGTGTTTCGGCTTCTGTCAAGGCC
GAGGAGGAGGTTGACCACATTCTTCCGCCGTATGAGGAGGAAGAGGGGGCCTGTGAGGCCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail