Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5645
Gene name
Locationscaffold_468:11832..12888
Strand-
Gene length (bp)1056
Transcript length (bp)840
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 66.74 34.38 99.11
CcL In ants, during behavior modification 8.33 2.16 14.50
CcD In ants, recently dead 10.16 2.94 17.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.621624 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5645
MLGNRLRQHTRLDITRRLGQGTTIRDKPVFTNSHSGDDDSAMRQNAHSPLPLRHQRALHAHAVLARADEAPPTSP
PSPESAVTASASDSNSTPSPDGFDSPSPSPSPSPSSSSGPTSSGTGPTSGPACFTTTTLTTTTCPLQSSGFGTCT
TTVLSSSACAPGLYCTTHTASSNNNTATTICMRRQDAPDLIITVVFAAITFLGLVGLIFSCCRDSFRRRARSGQQ
IAVDDAKMTSGSGSKAAHRPLMPREEDDEDDLGANPFLDDHHVNPEPYHHLQGK
Coding >Ophio5|5645
ATGCTCGGCAATCGCCTCAGGCAACACACGCGGCTCGACATCACAAGACGTCTAGGGCAAGGAACAACGATAAGG
GACAAACCAGTCTTCACCAACAGCCATTCAGGAGACGACGACTCCGCCATGCGCCAAAACGCCCACTCCCCTCTT
CCCCTCCGCCACCAACGCGCCCTTCACGCCCACGCCGTCCTCGCCCGCGCCGACGAAGCTCCTCCGACGTCTCCT
CCTTCGCCGGAAAGCGCCGTCACCGCCTCGGCGTCCGACAGCAACAGCACCCCCAGCCCGGACGGCTTTGACTCC
CCCTCCCCCTCCCCCTCCCCCTCCCCCTCCTCTTCATCCGGCCCCACCTCCTCCGGCACGGGCCCCACCTCGGGC
CCGGCCTGCTTCACCACCACCACCCTGACAACGACAACCTGCCCTCTCCAATCCTCCGGCTTCGGGACCTGCACC
ACCACCGTTCTTTCATCCAGCGCCTGCGCCCCAGGCCTGTACTGCACAACCCACACCGCCTCCTCCAACAATAAC
ACGGCCACCACCATCTGCATGCGCCGCCAAGACGCCCCTGACCTCATCATAACCGTCGTCTTCGCCGCCATCACC
TTTTTAGGTCTCGTCGGCCTCATCTTCTCCTGCTGTCGCGATAGCTTCCGTCGCCGCGCCAGGTCGGGACAGCAA
ATCGCCGTCGACGACGCCAAGATGACCTCCGGCAGTGGCAGCAAGGCCGCTCATCGGCCGCTCATGCCGCGTGAG
GAGGACGACGAAGACGATCTTGGTGCGAATCCTTTCCTCGATGACCATCATGTGAATCCTGAGCCCTACCATCAC
CTTCAGGGGAAG
Transcript >Ophio5|5645
ATGCTCGGCAATCGCCTCAGGCAACACACGCGGCTCGACATCACAAGACGTCTAGGGCAAGGAACAACGATAAGG
GACAAACCAGTCTTCACCAACAGCCATTCAGGAGACGACGACTCCGCCATGCGCCAAAACGCCCACTCCCCTCTT
CCCCTCCGCCACCAACGCGCCCTTCACGCCCACGCCGTCCTCGCCCGCGCCGACGAAGCTCCTCCGACGTCTCCT
CCTTCGCCGGAAAGCGCCGTCACCGCCTCGGCGTCCGACAGCAACAGCACCCCCAGCCCGGACGGCTTTGACTCC
CCCTCCCCCTCCCCCTCCCCCTCCCCCTCCTCTTCATCCGGCCCCACCTCCTCCGGCACGGGCCCCACCTCGGGC
CCGGCCTGCTTCACCACCACCACCCTGACAACGACAACCTGCCCTCTCCAATCCTCCGGCTTCGGGACCTGCACC
ACCACCGTTCTTTCATCCAGCGCCTGCGCCCCAGGCCTGTACTGCACAACCCACACCGCCTCCTCCAACAATAAC
ACGGCCACCACCATCTGCATGCGCCGCCAAGACGCCCCTGACCTCATCATAACCGTCGTCTTCGCCGCCATCACC
TTTTTAGGTCTCGTCGGCCTCATCTTCTCCTGCTGTCGCGATAGCTTCCGTCGCCGCGCCAGGTCGGGACAGCAA
ATCGCCGTCGACGACGCCAAGATGACCTCCGGCAGTGGCAGCAAGGCCGCTCATCGGCCGCTCATGCCGCGTGAG
GAGGACGACGAAGACGATCTTGGTGCGAATCCTTTCCTCGATGACCATCATGTGAATCCTGAGCCCTACCATCAC
CTTCAGGGGAAGTGA
Gene >Ophio5|5645
ATGCTCGGCAATCGCCTCAGGCAACGTGAGACACCACACCAGTTCGGTCCATTCTCCCTCCCCCATATCCTTCTT
TTTTTTTTTGACTCTTTCTTTCCCTCGTATTTTTTTTCCCCCCCCTCTCTGACGCCATTTCTCTACTGACTCCCT
GATCTTCTTTCTGGCGACCGGCATCTTCGGGGGGACTCGCATCTCGACCTGTTTGCTTCTTGATTGGTACTACCA
CACAAACCTCTCTTAGACACGCGGCTCGACATCACAAGACGTCTAGGGCAAGGAACAACGATAAGGGACAAACCA
GTCTTCACCAACAGCCATTCAGGAGACGACGACTCCGCCATGCGCCAAAACGCCCACTCCCCTCTTCCCCTCCGC
CACCAACGCGCCCTTCACGCCCACGCCGTCCTCGCCCGCGCCGACGAAGCTCCTCCGACGTCTCCTCCTTCGCCG
GAAAGCGCCGTCACCGCCTCGGCGTCCGACAGCAACAGCACCCCCAGCCCGGACGGCTTTGACTCCCCCTCCCCC
TCCCCCTCCCCCTCCCCCTCCTCTTCATCCGGCCCCACCTCCTCCGGCACGGGCCCCACCTCGGGCCCGGCCTGC
TTCACCACCACCACCCTGACAACGACAACCTGCCCTCTCCAATCCTCCGGCTTCGGGACCTGCACCACCACCGTT
CTTTCATCCAGCGCCTGCGCCCCAGGCCTGTACTGCACAACCCACACCGCCTCCTCCAACAATAACACGGCCACC
ACCATCTGCATGCGCCGCCAAGACGCCCCTGACCTCATCATAACCGTCGTCTTCGCCGCCATCACCTTTTTAGGT
CTCGTCGGCCTCATCTTCTCCTGCTGTCGCGATAGCTTCCGTCGCCGCGCCAGGTCGGGACAGCAAATCGCCGTC
GACGACGCCAAGATGACCTCCGGCAGTGGCAGCAAGGCCGCTCATCGGCCGCTCATGCCGCGTGAGGAGGACGAC
GAAGACGATCTTGGTGCGAATCCTTTCCTCGATGACCATCATGTGAATCCTGAGCCCTACCATCACCTTCAGGGG
AAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail