Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5643
Gene name
Locationscaffold_468:6954..10977
Strand+
Gene length (bp)4023
Transcript length (bp)3897
Coding sequence length (bp)3894
Protein length (aa) 1298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13945 NST1 Salt tolerance down-regulator 6.7E-50 152 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6RW62|NST1_BOTFB Stress response protein nst1 OS=Botryotinia fuckeliana (strain B05.10) GN=nst1 PE=3 SV=1 187 1294 0.0E+00
sp|Q7S8V3|NST1_NEUCR Stress response protein nst1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nst1 PE=3 SV=2 31 1295 8.0E-159
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 192 1289 1.0E-138
sp|A4R2R1|NST1_MAGO7 Stress response protein NST1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NST1 PE=3 SV=2 15 814 4.0E-138
sp|Q2GZN9|NST1_CHAGB Stress response protein NST1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NST1 PE=3 SV=1 189 649 6.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6RW62|NST1_BOTFB Stress response protein nst1 OS=Botryotinia fuckeliana (strain B05.10) GN=nst1 PE=3 SV=1 187 1294 0.0E+00
sp|Q7S8V3|NST1_NEUCR Stress response protein nst1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nst1 PE=3 SV=2 31 1295 8.0E-159
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 192 1289 1.0E-138
sp|A4R2R1|NST1_MAGO7 Stress response protein NST1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NST1 PE=3 SV=2 15 814 4.0E-138
sp|Q2GZN9|NST1_CHAGB Stress response protein NST1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NST1 PE=3 SV=1 189 649 6.0E-124
sp|A7EMM3|NST1_SCLS1 Stress response protein nst1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nst1 PE=3 SV=1 187 798 1.0E-111
sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NST1 PE=3 SV=3 70 641 3.0E-99
sp|Q0CP15|NST1_ASPTN Stress response protein nst1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nst1 PE=3 SV=1 196 590 6.0E-93
sp|Q1E1H4|NST1_COCIM Stress response protein NST1 OS=Coccidioides immitis (strain RS) GN=NST1 PE=3 SV=2 192 616 9.0E-90
sp|Q5B3C8|NST1_EMENI Stress response protein nst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nst1 PE=3 SV=1 82 552 2.0E-84
sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nst1 PE=3 SV=1 185 543 6.0E-83
sp|Q4WXQ7|NST1_ASPFU Stress response protein nst1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nst1 PE=3 SV=1 185 543 8.0E-83
sp|Q09863|NST1_SCHPO Stress response protein nst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nst1 PE=1 SV=1 196 606 2.0E-77
sp|Q6CBW0|NST1_YARLI Stress response protein NST1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NST1 PE=3 SV=1 204 613 4.0E-46
sp|A7EMM3|NST1_SCLS1 Stress response protein nst1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nst1 PE=3 SV=1 897 1294 5.0E-37
sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NST1 PE=3 SV=2 362 682 8.0E-37
sp|A1CKE0|NST1_ASPCL Stress response protein nst1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nst1 PE=3 SV=1 370 531 8.0E-36
sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NST1 PE=3 SV=2 195 275 5.0E-33
sp|A4R2R1|NST1_MAGO7 Stress response protein NST1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NST1 PE=3 SV=2 916 1291 8.0E-23
sp|Q0CP15|NST1_ASPTN Stress response protein nst1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nst1 PE=3 SV=1 937 1289 9.0E-23
sp|P0CP35|NST1_CRYNB Stress response protein NST1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NST1 PE=3 SV=1 365 683 1.0E-22
sp|P0CP34|NST1_CRYNJ Stress response protein NST1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NST1 PE=3 SV=1 365 683 1.0E-22
sp|Q5B3C8|NST1_EMENI Stress response protein nst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nst1 PE=3 SV=1 891 1289 1.0E-22
sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nst1 PE=3 SV=1 921 1289 1.0E-20
sp|Q1E1H4|NST1_COCIM Stress response protein NST1 OS=Coccidioides immitis (strain RS) GN=NST1 PE=3 SV=2 1052 1291 2.0E-20
sp|Q4WXQ7|NST1_ASPFU Stress response protein nst1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nst1 PE=3 SV=1 921 1289 4.0E-20
sp|A1CKE0|NST1_ASPCL Stress response protein nst1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nst1 PE=3 SV=1 914 1289 2.0E-16
sp|A3LYI0|NST1_PICST Stress response protein NST1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NST1 PE=3 SV=2 381 516 1.0E-15
sp|A5DLJ8|NST1_PICGU Stress response protein NST1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NST1 PE=3 SV=2 378 513 2.0E-13
sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NST1 PE=3 SV=1 195 273 1.0E-12
sp|Q5A2K0|NST1_CANAL Stress response protein NST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NST1 PE=3 SV=1 185 273 1.0E-12
sp|Q0UJJ7|NST1_PHANO Stress response protein NST1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NST1 PE=3 SV=3 923 1293 2.0E-12
sp|A3LYI0|NST1_PICST Stress response protein NST1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NST1 PE=3 SV=2 195 273 7.0E-11
sp|A5DLJ8|NST1_PICGU Stress response protein NST1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NST1 PE=3 SV=2 196 276 1.0E-09
sp|Q6FM98|NST1_CANGA Stress response protein NST1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NST1 PE=3 SV=1 212 272 2.0E-09
sp|Q5A2K0|NST1_CANAL Stress response protein NST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NST1 PE=3 SV=1 463 516 2.0E-08
sp|P53935|NST1_YEAST Stress response protein NST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NST1 PE=1 SV=1 212 267 3.0E-08
sp|A6ZRZ0|NST1_YEAS7 Stress response protein NST1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NST1 PE=3 SV=1 212 267 3.0E-08
sp|Q6CTC3|NST1_KLULA Stress response protein NST1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NST1 PE=3 SV=1 472 647 1.0E-07
sp|Q75CK5|NST1_ASHGO Stress response protein NST1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NST1 PE=3 SV=2 212 267 3.0E-06
sp|Q6BUT3|NST1_DEBHA Stress response protein NST1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NST1 PE=3 SV=2 374 440 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.765 0.5179 0.1291 0.0531 0.1166 0.0107 0.1702 0.0633 0.2986 0.0385

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup999
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5191
Ophiocordyceps australis map64 (Brazil) OphauB2|3439
Ophiocordyceps camponoti-floridani Ophcf2|04674
Ophiocordyceps camponoti-rufipedis Ophun1|4644
Ophiocordyceps camponoti-rufipedis Ophun1|611
Ophiocordyceps kimflemingae Ophio5|5643 (this protein)
Ophiocordyceps subramaniannii Hirsu2|846

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5643
MPASKQTPAAPASAPAPATAPPPAPTSPRNTAKYTNKDGSKFITVPKPSAEDSSQPSTPTATLKLGEPPATPPHT
LDAPAPTVNRKKQKRRQKAAVKAAAANGRAPSPPEPPLHPPPPQPAASDDDIEDPLVPAHGSSSLPPSNGHSDLT
AAKAKKGKKKKKKNASTTDAAQNPTAAETIDALINSRPPAGSRDKIWSTSSQEERERIKEFWLGLGEDERKSLVK
VEKDAVLKKMKEQQKHTCSCTVCGRKRTAIEEELEGLYDAYYLELEQFANQGEPPAILPPPSRDYPIRPQRRLPS
RYATQPPSRGRIVEHVGDVEGEGDDDDDDDLDEVYSEEDAEDDDVYSDEEPPEDYHGPHERDVADFLTFGNSLQV
KGGILTVADDLLKNDGKRFIEMMEQLAERRMAREEDAREHLSRTFGGHPNGAYSEPQSQPPQDDDEFEEDDDEED
DDYEESQEEEFEDDEEQMNDEQRMEEGRRMFQIFAARMFEQRVLSAYREKVAKDRQQKLIEELDEETRQNDEQKA
KKAKSAQRKKDRAAQKKQVQAEEKARKEAERAAEEQARIEAEQQKAADQRQKAEEKRKQKEAQRKMEEDARLKKE
AERQRRIHEQREKQAEQERKAREAKERDKKLKEEQRLREKEAREQREREAQQRKEKLERLEREKREKREKDARAS
AKAQREKAHHQHHHSHQQQHHNHHQPQQPAPAPPPQAQLQPPPPPPPPPAPPQPQQQAAKRGHHLVSMPTTSNPT
SYASPKVPVATPAIPKAPTPMRTRPASNQPPPETGPASQAPSGPSQNPSPHSATPIRASPAPMGQERKTSGSGAT
PAATMAPVAPAPAPAAPTQHPQAHAQAQLQQLQLQQHQQLQQQQLQLQQQLQQHAHQSQQQHTHPHPHPHAHHQT
QPMSPQTRPPSHTPPFPVPPMAMQPPPGIPHQPHQRPPGFPSPMGHDTMFPLGFRPNPNVMMPPPGINGPARNYP
PAMSMPPPGFSQGPPTGDQFPMVQAYGMPKEGPTPAHVRQTSTGYDGAPSAANTTTTVAAAATAAVTTTAPAPTM
PSAPIGRPAPIGRPVSIPQGQPRDDGADAKRLGSRVLVEDDEPLSSDVSLGGGLRNQPPGPRSGGFGTSPFLDAS
FPMGAHNPWGPHDAASQQFGPGGFGSTTWASPTMQPGFSVTSPAPVLGSLRTSAQPRHVVLRLMLCQACKDLAST
SSADADGYIDFVVVLSHIELQTGDGSIGTQDLLNLSDTEGNSSNGGGTFEVRGLNGPGQPGIRWLPDAHDGLNRH
LRAVGAPGEIGSPLTGHASIRGI
Coding >Ophio5|5643
ATGCCGGCCTCCAAGCAGACGCCAGCCGCTCCCGCTTCCGCCCCCGCCCCCGCTACAGCTCCCCCTCCGGCGCCG
ACATCGCCTCGAAATACGGCAAAATACACGAACAAGGATGGATCCAAGTTCATCACGGTGCCCAAGCCCTCTGCC
GAAGACTCATCGCAGCCCTCGACCCCCACCGCTACCCTCAAGCTAGGCGAACCCCCCGCAACGCCCCCCCACACT
CTCGACGCGCCCGCTCCGACGGTGAACCGCAAGAAACAGAAACGTCGTCAAAAGGCCGCTGTCAAGGCCGCTGCC
GCTAACGGCCGCGCTCCCAGCCCGCCCGAGCCGCCTCTTCATCCTCCTCCGCCCCAACCCGCCGCTAGCGACGAC
GATATCGAGGATCCTCTTGTTCCCGCCCATGGCTCTTCTTCTCTGCCCCCCTCCAACGGCCACTCGGACCTGACT
GCCGCCAAGGCCAAAAAGGGGAAGAAGAAGAAGAAGAAGAACGCGTCTACGACCGATGCCGCCCAGAACCCCACT
GCCGCCGAAACCATCGACGCCCTCATCAACTCTCGCCCCCCGGCAGGGTCTCGAGATAAGATCTGGAGCACCAGC
AGCCAGGAGGAGCGAGAGCGTATCAAGGAATTCTGGCTCGGCCTGGGTGAGGACGAGCGCAAGTCCCTGGTCAAG
GTGGAAAAGGATGCCGTGCTCAAAAAGATGAAGGAGCAGCAGAAGCACACCTGCAGCTGCACCGTCTGCGGCCGC
AAGAGGACCGCCATCGAGGAGGAGCTCGAGGGCCTCTACGACGCTTACTATCTCGAACTCGAGCAGTTCGCCAAC
CAGGGAGAGCCCCCGGCCATACTGCCTCCGCCCTCGCGAGACTATCCCATCCGCCCGCAACGCCGTCTGCCTTCC
CGCTACGCCACCCAGCCGCCCTCCCGCGGCCGTATAGTCGAACACGTCGGCGATGTCGAGGGCGAGGGCGACGAT
GATGACGACGACGACCTCGACGAAGTCTATAGCGAAGAAGACGCCGAGGACGACGACGTCTACAGCGACGAAGAG
CCTCCCGAAGACTACCACGGCCCTCACGAGCGAGACGTGGCCGACTTTCTGACGTTTGGCAACAGTCTTCAAGTC
AAAGGCGGCATCCTCACCGTTGCCGACGACCTCCTCAAAAACGACGGCAAGCGATTCATCGAGATGATGGAGCAG
CTCGCCGAACGCCGCATGGCCCGAGAGGAAGACGCTCGGGAGCATCTGTCGCGCACCTTTGGTGGTCACCCCAAC
GGCGCCTACTCGGAACCTCAAAGCCAGCCACCTCAGGACGATGACGAGTTCGAGGAGGATGACGACGAGGAAGAC
GATGACTATGAGGAGAGTCAGGAGGAAGAGTTCGAGGATGATGAGGAGCAGATGAACGACGAGCAACGTATGGAA
GAAGGCCGTCGCATGTTCCAGATCTTCGCCGCCAGAATGTTCGAACAGCGCGTCCTGTCGGCCTACCGGGAAAAA
GTGGCCAAGGACCGACAACAGAAGCTCATCGAGGAGCTCGACGAGGAGACGCGCCAGAACGATGAGCAAAAGGCC
AAGAAGGCTAAGAGTGCCCAGCGGAAGAAGGACCGGGCAGCGCAGAAAAAGCAGGTCCAGGCGGAGGAAAAGGCG
CGCAAGGAGGCGGAGCGCGCGGCCGAGGAGCAGGCCCGGATCGAGGCCGAGCAGCAAAAGGCGGCCGACCAGCGA
CAAAAGGCCGAGGAGAAGCGCAAGCAGAAGGAGGCTCAGCGCAAGATGGAGGAGGATGCCCGGCTCAAGAAGGAG
GCGGAGCGGCAACGGCGCATCCACGAGCAGCGGGAGAAGCAGGCCGAGCAGGAACGCAAGGCGCGCGAGGCCAAG
GAGCGCGATAAGAAGCTCAAGGAGGAGCAGCGGCTACGCGAAAAGGAGGCGCGCGAGCAGCGGGAGCGCGAGGCC
CAGCAGCGCAAGGAAAAGCTGGAGAGGCTGGAGCGCGAGAAGCGCGAGAAGCGCGAGAAGGACGCGAGGGCGTCG
GCCAAGGCGCAGCGGGAGAAGGCGCATCACCAACACCATCATTCGCATCAACAGCAGCATCATAATCACCACCAA
CCGCAGCAACCGGCCCCTGCGCCGCCGCCTCAAGCCCAGCTGCAGCCTCCTCCGCCGCCGCCGCCGCCGCCAGCG
CCGCCTCAACCGCAGCAGCAAGCGGCGAAGCGCGGTCACCACCTCGTTTCGATGCCGACGACGTCGAACCCGACG
AGCTACGCGTCTCCCAAGGTCCCGGTGGCCACGCCGGCCATTCCCAAGGCGCCGACGCCGATGCGGACGCGACCC
GCGTCGAATCAGCCGCCGCCGGAGACGGGGCCGGCGTCACAGGCCCCATCGGGACCGAGCCAGAACCCTTCACCT
CATTCGGCCACGCCCATCCGTGCCAGTCCGGCGCCGATGGGACAGGAGCGCAAGACGAGCGGAAGCGGCGCGACG
CCGGCTGCAACGATGGCCCCGGTCGCTCCGGCTCCGGCTCCGGCCGCGCCGACGCAGCATCCCCAGGCGCATGCT
CAGGCCCAGCTACAGCAGCTACAGCTTCAGCAACATCAACAGCTCCAGCAACAGCAGCTTCAACTTCAGCAGCAG
CTCCAGCAACATGCACACCAGAGTCAACAGCAGCACACTCATCCCCATCCCCATCCTCATGCCCATCACCAGACA
CAGCCCATGTCGCCGCAGACTCGGCCGCCGAGTCACACGCCGCCCTTCCCAGTGCCACCGATGGCCATGCAGCCA
CCCCCGGGCATCCCGCACCAGCCGCACCAACGGCCTCCGGGGTTCCCCAGCCCGATGGGCCACGACACCATGTTC
CCTCTCGGCTTCCGACCGAACCCCAACGTCATGATGCCCCCGCCCGGTATCAATGGGCCGGCCCGGAACTACCCA
CCGGCCATGTCGATGCCGCCGCCAGGCTTCTCCCAGGGTCCGCCCACAGGGGATCAGTTCCCCATGGTTCAGGCG
TACGGTATGCCAAAGGAAGGCCCGACGCCGGCCCACGTGCGGCAAACGTCGACTGGTTACGACGGTGCGCCCTCG
GCTGCGAACACGACGACGACGGTCGCGGCTGCGGCGACGGCGGCGGTGACGACGACTGCGCCCGCTCCCACGATG
CCCTCGGCCCCTATCGGTAGGCCGGCGCCTATAGGACGACCGGTCAGCATACCGCAGGGGCAGCCGCGAGACGAC
GGCGCCGACGCCAAGCGGCTAGGAAGCCGGGTGCTTGTCGAGGACGACGAGCCGCTATCGTCGGACGTGAGCCTG
GGCGGCGGGCTGCGCAATCAGCCGCCGGGACCTCGAAGCGGCGGCTTCGGGACGAGTCCCTTTTTGGACGCGAGC
TTTCCCATGGGAGCACACAATCCCTGGGGGCCGCACGACGCAGCGTCGCAGCAGTTCGGCCCGGGCGGATTCGGA
AGTACGACGTGGGCCTCGCCGACGATGCAGCCGGGCTTCAGCGTCACGTCACCGGCCCCCGTGCTGGGCTCCCTC
CGGACGTCGGCCCAGCCACGGCACGTGGTGTTGCGTCTGATGCTGTGCCAAGCCTGTAAAGATCTTGCCAGCACA
AGCAGCGCCGACGCCGACGGATACATCGACTTTGTGGTCGTCCTTTCGCATATTGAGTTGCAGACGGGTGACGGC
AGCATCGGGACGCAGGACCTGCTGAACCTGAGCGACACCGAGGGCAACAGCTCGAACGGAGGCGGGACGTTTGAG
GTGCGCGGCCTCAACGGACCGGGCCAGCCGGGCATCCGATGGCTTCCGGACGCCCACGACGGGCTCAACCGGCAC
CTGCGGGCTGTGGGCGCGCCCGGTGAGATTGGCAGCCCGCTCACGGGCCACGCCTCGATACGGGGGATC
Transcript >Ophio5|5643
ATGCCGGCCTCCAAGCAGACGCCAGCCGCTCCCGCTTCCGCCCCCGCCCCCGCTACAGCTCCCCCTCCGGCGCCG
ACATCGCCTCGAAATACGGCAAAATACACGAACAAGGATGGATCCAAGTTCATCACGGTGCCCAAGCCCTCTGCC
GAAGACTCATCGCAGCCCTCGACCCCCACCGCTACCCTCAAGCTAGGCGAACCCCCCGCAACGCCCCCCCACACT
CTCGACGCGCCCGCTCCGACGGTGAACCGCAAGAAACAGAAACGTCGTCAAAAGGCCGCTGTCAAGGCCGCTGCC
GCTAACGGCCGCGCTCCCAGCCCGCCCGAGCCGCCTCTTCATCCTCCTCCGCCCCAACCCGCCGCTAGCGACGAC
GATATCGAGGATCCTCTTGTTCCCGCCCATGGCTCTTCTTCTCTGCCCCCCTCCAACGGCCACTCGGACCTGACT
GCCGCCAAGGCCAAAAAGGGGAAGAAGAAGAAGAAGAAGAACGCGTCTACGACCGATGCCGCCCAGAACCCCACT
GCCGCCGAAACCATCGACGCCCTCATCAACTCTCGCCCCCCGGCAGGGTCTCGAGATAAGATCTGGAGCACCAGC
AGCCAGGAGGAGCGAGAGCGTATCAAGGAATTCTGGCTCGGCCTGGGTGAGGACGAGCGCAAGTCCCTGGTCAAG
GTGGAAAAGGATGCCGTGCTCAAAAAGATGAAGGAGCAGCAGAAGCACACCTGCAGCTGCACCGTCTGCGGCCGC
AAGAGGACCGCCATCGAGGAGGAGCTCGAGGGCCTCTACGACGCTTACTATCTCGAACTCGAGCAGTTCGCCAAC
CAGGGAGAGCCCCCGGCCATACTGCCTCCGCCCTCGCGAGACTATCCCATCCGCCCGCAACGCCGTCTGCCTTCC
CGCTACGCCACCCAGCCGCCCTCCCGCGGCCGTATAGTCGAACACGTCGGCGATGTCGAGGGCGAGGGCGACGAT
GATGACGACGACGACCTCGACGAAGTCTATAGCGAAGAAGACGCCGAGGACGACGACGTCTACAGCGACGAAGAG
CCTCCCGAAGACTACCACGGCCCTCACGAGCGAGACGTGGCCGACTTTCTGACGTTTGGCAACAGTCTTCAAGTC
AAAGGCGGCATCCTCACCGTTGCCGACGACCTCCTCAAAAACGACGGCAAGCGATTCATCGAGATGATGGAGCAG
CTCGCCGAACGCCGCATGGCCCGAGAGGAAGACGCTCGGGAGCATCTGTCGCGCACCTTTGGTGGTCACCCCAAC
GGCGCCTACTCGGAACCTCAAAGCCAGCCACCTCAGGACGATGACGAGTTCGAGGAGGATGACGACGAGGAAGAC
GATGACTATGAGGAGAGTCAGGAGGAAGAGTTCGAGGATGATGAGGAGCAGATGAACGACGAGCAACGTATGGAA
GAAGGCCGTCGCATGTTCCAGATCTTCGCCGCCAGAATGTTCGAACAGCGCGTCCTGTCGGCCTACCGGGAAAAA
GTGGCCAAGGACCGACAACAGAAGCTCATCGAGGAGCTCGACGAGGAGACGCGCCAGAACGATGAGCAAAAGGCC
AAGAAGGCTAAGAGTGCCCAGCGGAAGAAGGACCGGGCAGCGCAGAAAAAGCAGGTCCAGGCGGAGGAAAAGGCG
CGCAAGGAGGCGGAGCGCGCGGCCGAGGAGCAGGCCCGGATCGAGGCCGAGCAGCAAAAGGCGGCCGACCAGCGA
CAAAAGGCCGAGGAGAAGCGCAAGCAGAAGGAGGCTCAGCGCAAGATGGAGGAGGATGCCCGGCTCAAGAAGGAG
GCGGAGCGGCAACGGCGCATCCACGAGCAGCGGGAGAAGCAGGCCGAGCAGGAACGCAAGGCGCGCGAGGCCAAG
GAGCGCGATAAGAAGCTCAAGGAGGAGCAGCGGCTACGCGAAAAGGAGGCGCGCGAGCAGCGGGAGCGCGAGGCC
CAGCAGCGCAAGGAAAAGCTGGAGAGGCTGGAGCGCGAGAAGCGCGAGAAGCGCGAGAAGGACGCGAGGGCGTCG
GCCAAGGCGCAGCGGGAGAAGGCGCATCACCAACACCATCATTCGCATCAACAGCAGCATCATAATCACCACCAA
CCGCAGCAACCGGCCCCTGCGCCGCCGCCTCAAGCCCAGCTGCAGCCTCCTCCGCCGCCGCCGCCGCCGCCAGCG
CCGCCTCAACCGCAGCAGCAAGCGGCGAAGCGCGGTCACCACCTCGTTTCGATGCCGACGACGTCGAACCCGACG
AGCTACGCGTCTCCCAAGGTCCCGGTGGCCACGCCGGCCATTCCCAAGGCGCCGACGCCGATGCGGACGCGACCC
GCGTCGAATCAGCCGCCGCCGGAGACGGGGCCGGCGTCACAGGCCCCATCGGGACCGAGCCAGAACCCTTCACCT
CATTCGGCCACGCCCATCCGTGCCAGTCCGGCGCCGATGGGACAGGAGCGCAAGACGAGCGGAAGCGGCGCGACG
CCGGCTGCAACGATGGCCCCGGTCGCTCCGGCTCCGGCTCCGGCCGCGCCGACGCAGCATCCCCAGGCGCATGCT
CAGGCCCAGCTACAGCAGCTACAGCTTCAGCAACATCAACAGCTCCAGCAACAGCAGCTTCAACTTCAGCAGCAG
CTCCAGCAACATGCACACCAGAGTCAACAGCAGCACACTCATCCCCATCCCCATCCTCATGCCCATCACCAGACA
CAGCCCATGTCGCCGCAGACTCGGCCGCCGAGTCACACGCCGCCCTTCCCAGTGCCACCGATGGCCATGCAGCCA
CCCCCGGGCATCCCGCACCAGCCGCACCAACGGCCTCCGGGGTTCCCCAGCCCGATGGGCCACGACACCATGTTC
CCTCTCGGCTTCCGACCGAACCCCAACGTCATGATGCCCCCGCCCGGTATCAATGGGCCGGCCCGGAACTACCCA
CCGGCCATGTCGATGCCGCCGCCAGGCTTCTCCCAGGGTCCGCCCACAGGGGATCAGTTCCCCATGGTTCAGGCG
TACGGTATGCCAAAGGAAGGCCCGACGCCGGCCCACGTGCGGCAAACGTCGACTGGTTACGACGGTGCGCCCTCG
GCTGCGAACACGACGACGACGGTCGCGGCTGCGGCGACGGCGGCGGTGACGACGACTGCGCCCGCTCCCACGATG
CCCTCGGCCCCTATCGGTAGGCCGGCGCCTATAGGACGACCGGTCAGCATACCGCAGGGGCAGCCGCGAGACGAC
GGCGCCGACGCCAAGCGGCTAGGAAGCCGGGTGCTTGTCGAGGACGACGAGCCGCTATCGTCGGACGTGAGCCTG
GGCGGCGGGCTGCGCAATCAGCCGCCGGGACCTCGAAGCGGCGGCTTCGGGACGAGTCCCTTTTTGGACGCGAGC
TTTCCCATGGGAGCACACAATCCCTGGGGGCCGCACGACGCAGCGTCGCAGCAGTTCGGCCCGGGCGGATTCGGA
AGTACGACGTGGGCCTCGCCGACGATGCAGCCGGGCTTCAGCGTCACGTCACCGGCCCCCGTGCTGGGCTCCCTC
CGGACGTCGGCCCAGCCACGGCACGTGGTGTTGCGTCTGATGCTGTGCCAAGCCTGTAAAGATCTTGCCAGCACA
AGCAGCGCCGACGCCGACGGATACATCGACTTTGTGGTCGTCCTTTCGCATATTGAGTTGCAGACGGGTGACGGC
AGCATCGGGACGCAGGACCTGCTGAACCTGAGCGACACCGAGGGCAACAGCTCGAACGGAGGCGGGACGTTTGAG
GTGCGCGGCCTCAACGGACCGGGCCAGCCGGGCATCCGATGGCTTCCGGACGCCCACGACGGGCTCAACCGGCAC
CTGCGGGCTGTGGGCGCGCCCGGTGAGATTGGCAGCCCGCTCACGGGCCACGCCTCGATACGGGGGATCTAG
Gene >Ophio5|5643
ATGCCGGCCTCCAAGCAGACGCCAGCCGCTCCCGCTTCCGCCCCCGCCCCCGCTACAGCTCCCCCTCCGGCGCCG
ACATCGCCTCGAAATACGGCAAAATACACGAACAAGGATGGATCCAAGTTCATCACGGTGCCCAAGCCCTCTGCC
GAAGACTCATCGCAGCCCTCGACCCCCACCGCTACCCTCAAGCTAGGCGAACCCCCCGCAACGCCCCCCCACACT
CTCGACGCGCCCGCTCCGACGGTGAACCGCAAGAAACAGAAACGTCGTCAAAAGGCCGCTGTCAAGGCCGCTGCC
GCTAACGGCCGCGCTCCCAGCCCGCCCGAGCCGCCTCTTCATCCTCCTCCGCCCCAACCCGCCGCTAGCGACGAC
GATATCGAGGATCCTCTTGTTCCCGCCCATGGCTCTTCTTCTCTGCCCCCCTCCAACGGCCACTCGGACCTGACT
GCCGCCAAGGCCAAAAAGGGGAAGAAGAAGAAGAAGAAGAACGCGTCTACGACCGATGCCGCCCAGAACCCCACT
GCCGCCGAAACCATCGACGCCCTCATCAACTCTCGCCCCCCGGCAGGGTCTCGAGATAAGATCTGGAGCACCAGC
AGCCAGGAGGAGCGAGAGCGTATCAAGGAATTCTGGCTCGGCCTGGGTGAGGACGAGCGCAAGTCCCTGGTCAAG
GTGGAAAAGGATGCCGTGCTCAAAAAGATGAAGGAGCAGCAGAAGCACACCTGCAGCTGCACCGTCTGCGGCCGC
AAGAGGACCGCCATCGAGGAGGAGCTCGAGGGCCTCTACGACGCTTACTATCTCGAACTCGAGCAGTTCGCCAAC
CAGGGAGAGCCCCCGGCCATACTGCCTCCGCCCTCGCGAGACTATCCCATCCGCCCGCAACGCCGTCTGCCTTCC
CGCTACGCCACCCAGCCGCCCTCCCGCGGCCGTATAGTCGAACACGTCGGCGATGTCGAGGGCGAGGGCGACGAT
GATGACGACGACGACCTCGACGAAGTCTATAGCGAAGAAGACGCCGAGGACGACGACGTCTACAGCGACGAAGAG
CCTCCCGAAGACTACCACGGCCCTCACGAGCGAGACGTGGCCGACTTTCTGACGTTTGGCAACAGTCTTCAAGTC
AAAGGTACGAGCCCCCCCCCCCCCCCAAATGCGTCACTCATCCAAGCCCACCTGCTGACATGGAACCCAGGCGGC
ATCCTCACCGTTGCCGACGACCTCCTCAAAAACGACGGCAAGCGATTCATCGAGATGATGGAGCAGCTCGCCGAA
CGCCGCATGGCCCGAGAGGAAGACGCTCGGGAGCATCTGTCGCGCACCTTTGGTGGTCACCCCAACGGCGCCTAC
TCGGAACCTCAAAGCCAGCCACCTCAGGACGATGACGAGTTCGAGGAGGATGACGACGAGGAAGACGATGACTAT
GAGGAGAGTCAGGAGGAAGAGTTCGAGGATGATGAGGTACAGTCGAACGCCACACCACCAAATCTGTCGCCTGCT
AACCACCCTCACCGCGGCTAGGAGCAGATGAACGACGAGCAACGTATGGAAGAAGGCCGTCGCATGTTCCAGATC
TTCGCCGCCAGAATGTTCGAACAGCGCGTCCTGTCGGCCTACCGGGAAAAAGTGGCCAAGGACCGACAACAGAAG
CTCATCGAGGAGCTCGACGAGGAGACGCGCCAGAACGATGAGCAAAAGGCCAAGAAGGCTAAGAGTGCCCAGCGG
AAGAAGGACCGGGCAGCGCAGAAAAAGCAGGTCCAGGCGGAGGAAAAGGCGCGCAAGGAGGCGGAGCGCGCGGCC
GAGGAGCAGGCCCGGATCGAGGCCGAGCAGCAAAAGGCGGCCGACCAGCGACAAAAGGCCGAGGAGAAGCGCAAG
CAGAAGGAGGCTCAGCGCAAGATGGAGGAGGATGCCCGGCTCAAGAAGGAGGCGGAGCGGCAACGGCGCATCCAC
GAGCAGCGGGAGAAGCAGGCCGAGCAGGAACGCAAGGCGCGCGAGGCCAAGGAGCGCGATAAGAAGCTCAAGGAG
GAGCAGCGGCTACGCGAAAAGGAGGCGCGCGAGCAGCGGGAGCGCGAGGCCCAGCAGCGCAAGGAAAAGCTGGAG
AGGCTGGAGCGCGAGAAGCGCGAGAAGCGCGAGAAGGACGCGAGGGCGTCGGCCAAGGCGCAGCGGGAGAAGGCG
CATCACCAACACCATCATTCGCATCAACAGCAGCATCATAATCACCACCAACCGCAGCAACCGGCCCCTGCGCCG
CCGCCTCAAGCCCAGCTGCAGCCTCCTCCGCCGCCGCCGCCGCCGCCAGCGCCGCCTCAACCGCAGCAGCAAGCG
GCGAAGCGCGGTCACCACCTCGTTTCGATGCCGACGACGTCGAACCCGACGAGCTACGCGTCTCCCAAGGTCCCG
GTGGCCACGCCGGCCATTCCCAAGGCGCCGACGCCGATGCGGACGCGACCCGCGTCGAATCAGCCGCCGCCGGAG
ACGGGGCCGGCGTCACAGGCCCCATCGGGACCGAGCCAGAACCCTTCACCTCATTCGGCCACGCCCATCCGTGCC
AGTCCGGCGCCGATGGGACAGGAGCGCAAGACGAGCGGAAGCGGCGCGACGCCGGCTGCAACGATGGCCCCGGTC
GCTCCGGCTCCGGCTCCGGCCGCGCCGACGCAGCATCCCCAGGCGCATGCTCAGGCCCAGCTACAGCAGCTACAG
CTTCAGCAACATCAACAGCTCCAGCAACAGCAGCTTCAACTTCAGCAGCAGCTCCAGCAACATGCACACCAGAGT
CAACAGCAGCACACTCATCCCCATCCCCATCCTCATGCCCATCACCAGACACAGCCCATGTCGCCGCAGACTCGG
CCGCCGAGTCACACGCCGCCCTTCCCAGTGCCACCGATGGCCATGCAGCCACCCCCGGGCATCCCGCACCAGCCG
CACCAACGGCCTCCGGGGTTCCCCAGCCCGATGGGCCACGACACCATGTTCCCTCTCGGCTTCCGACCGAACCCC
AACGTCATGATGCCCCCGCCCGGTATCAATGGGCCGGCCCGGAACTACCCACCGGCCATGTCGATGCCGCCGCCA
GGCTTCTCCCAGGGTCCGCCCACAGGGGATCAGTTCCCCATGGTTCAGGCGTACGGTATGCCAAAGGAAGGCCCG
ACGCCGGCCCACGTGCGGCAAACGTCGACTGGTTACGACGGTGCGCCCTCGGCTGCGAACACGACGACGACGGTC
GCGGCTGCGGCGACGGCGGCGGTGACGACGACTGCGCCCGCTCCCACGATGCCCTCGGCCCCTATCGGTAGGCCG
GCGCCTATAGGACGACCGGTCAGCATACCGCAGGGGCAGCCGCGAGACGACGGCGCCGACGCCAAGCGGCTAGGA
AGCCGGGTGCTTGTCGAGGACGACGAGCCGCTATCGTCGGACGTGAGCCTGGGCGGCGGGCTGCGCAATCAGCCG
CCGGGACCTCGAAGCGGCGGCTTCGGGACGAGTCCCTTTTTGGACGCGAGCTTTCCCATGGGAGCACACAATCCC
TGGGGGCCGCACGACGCAGCGTCGCAGCAGTTCGGCCCGGGCGGATTCGGAAGTACGACGTGGGCCTCGCCGACG
ATGCAGCCGGGCTTCAGCGTCACGTCACCGGCCCCCGTGCTGGGCTCCCTCCGGACGTCGGCCCAGCCACGGCAC
GTGGTGTTGCGTCTGATGCTGTGCCAAGCCTGTAAAGATCTTGCCAGCACAAGCAGCGCCGACGCCGACGGATAC
ATCGACTTTGTGGTCGTCCTTTCGCATATTGAGTTGCAGACGGGTGACGGCAGCATCGGGACGCAGGACCTGCTG
AACCTGAGCGACACCGAGGGCAACAGCTCGAACGGAGGCGGGACGTTTGAGGTGCGCGGCCTCAACGGACCGGGC
CAGCCGGGCATCCGATGGCTTCCGGACGCCCACGACGGGCTCAACCGGCACCTGCGGGCTGTGGGCGCGCCCGGT
GAGATTGGCAGCCCGCTCACGGGCCACGCCTCGATACGGGGGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail