Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5638
Gene name
Locationscaffold_467:11658..12336
Strand+
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05175 MTS Methyltransferase small domain 1.4E-14 34 177
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-10 67 159
PF13847 Methyltransf_31 Methyltransferase domain 1.8E-10 65 189
PF13489 Methyltransf_23 Methyltransferase domain 5.8E-09 61 182
PF08241 Methyltransf_11 Methyltransferase domain 7.8E-09 67 159
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 1.8E-08 63 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q58338|Y928_METJA Putative protein methyltransferase MJ0928 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0928 PE=3 SV=1 30 191 5.0E-22
sp|A5UFI6|RSMC_HAEIG Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittGG) GN=rsmC PE=3 SV=1 61 182 3.0E-10
sp|Q1QUF2|RSMC_CHRSD Ribosomal RNA small subunit methyltransferase C OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rsmC PE=3 SV=1 11 182 4.0E-10
sp|Q0VP64|RSMC_ALCBS Ribosomal RNA small subunit methyltransferase C OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rsmC PE=3 SV=1 67 207 6.0E-10
sp|A0KPP9|RSMC_AERHH Ribosomal RNA small subunit methyltransferase C OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rsmC PE=3 SV=1 59 182 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q58338|Y928_METJA Putative protein methyltransferase MJ0928 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0928 PE=3 SV=1 30 191 5.0E-22
sp|A5UFI6|RSMC_HAEIG Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittGG) GN=rsmC PE=3 SV=1 61 182 3.0E-10
sp|Q1QUF2|RSMC_CHRSD Ribosomal RNA small subunit methyltransferase C OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rsmC PE=3 SV=1 11 182 4.0E-10
sp|Q0VP64|RSMC_ALCBS Ribosomal RNA small subunit methyltransferase C OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rsmC PE=3 SV=1 67 207 6.0E-10
sp|A0KPP9|RSMC_AERHH Ribosomal RNA small subunit methyltransferase C OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rsmC PE=3 SV=1 59 182 1.0E-09
sp|A3N3U3|RSMC_ACTP2 Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rsmC PE=3 SV=1 67 182 2.0E-09
sp|A5UBC5|RSMC_HAEIE Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain PittEE) GN=rsmC PE=3 SV=1 61 182 4.0E-09
sp|P45253|PRMC_HAEIN Release factor glutamine methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prmC PE=3 SV=1 55 195 6.0E-09
sp|Q4QPN2|RSMC_HAEI8 Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain 86-028NP) GN=rsmC PE=3 SV=1 61 182 6.0E-09
sp|P44453|RSMC_HAEIN Ribosomal RNA small subunit methyltransferase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rsmC PE=3 SV=1 61 173 8.0E-09
sp|A4SIE3|RSMC_AERS4 Ribosomal RNA small subunit methyltransferase C OS=Aeromonas salmonicida (strain A449) GN=rsmC PE=3 SV=1 34 182 1.0E-08
sp|B3GZF1|RSMC_ACTP7 Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rsmC PE=3 SV=1 67 182 1.0E-08
sp|B8E1A7|PRMA_DICTD Ribosomal protein L11 methyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=prmA PE=3 SV=1 48 151 1.0E-08
sp|B0BU33|RSMC_ACTPJ Ribosomal RNA small subunit methyltransferase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rsmC PE=3 SV=1 67 182 3.0E-08
sp|B4TGY8|RSMC_SALHS Ribosomal RNA small subunit methyltransferase C OS=Salmonella heidelberg (strain SL476) GN=rsmC PE=3 SV=1 29 136 4.0E-08
sp|A9N7C4|RSMC_SALPB Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rsmC PE=3 SV=1 29 136 4.0E-08
sp|Q65S65|RSMC_MANSM Ribosomal RNA small subunit methyltransferase C OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rsmC PE=3 SV=1 23 182 5.0E-08
sp|Q9CHX0|PRMC_LACLA Release factor glutamine methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prmC PE=3 SV=1 66 192 7.0E-08
sp|Q5NEL0|PRMB_FRATT 50S ribosomal protein L3 glutamine methyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=prmB PE=3 SV=1 65 191 8.0E-08
sp|Q9CM79|RSMC_PASMU Ribosomal RNA small subunit methyltransferase C OS=Pasteurella multocida (strain Pm70) GN=rsmC PE=3 SV=1 61 182 9.0E-08
sp|B7IFP7|PRMA_THEAB Ribosomal protein L11 methyltransferase OS=Thermosipho africanus (strain TCF52B) GN=prmA PE=3 SV=1 63 148 9.0E-08
sp|B5R9T9|RSMC_SALG2 Ribosomal RNA small subunit methyltransferase C OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rsmC PE=3 SV=1 29 136 9.0E-08
sp|A3MRB1|PRMA_BURM7 Ribosomal protein L11 methyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|A2S5P8|PRMA_BURM9 Ribosomal protein L11 methyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|Q62GX2|PRMA_BURMA Ribosomal protein L11 methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|A1V0M1|PRMA_BURMS Ribosomal protein L11 methyltransferase OS=Burkholderia mallei (strain SAVP1) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|Q63QN9|PRMA_BURPS Ribosomal protein L11 methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|Q3JNI0|PRMA_BURP1 Ribosomal protein L11 methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|A3NDQ7|PRMA_BURP6 Ribosomal protein L11 methyltransferase OS=Burkholderia pseudomallei (strain 668) GN=prmA PE=3 SV=1 52 132 1.0E-07
sp|Q57G51|RSMC_SALCH Ribosomal RNA small subunit methyltransferase C OS=Salmonella choleraesuis (strain SC-B67) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|B5R2I6|RSMC_SALEP Ribosomal RNA small subunit methyltransferase C OS=Salmonella enteritidis PT4 (strain P125109) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|Q8ZJW6|RSMC_SALTY Ribosomal RNA small subunit methyltransferase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|Q8Z0V2|RSMC_SALTI Ribosomal RNA small subunit methyltransferase C OS=Salmonella typhi GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|B5F512|RSMC_SALA4 Ribosomal RNA small subunit methyltransferase C OS=Salmonella agona (strain SL483) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|Q5PK16|RSMC_SALPA Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|B5BL07|RSMC_SALPK Ribosomal RNA small subunit methyltransferase C OS=Salmonella paratyphi A (strain AKU_12601) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|B4TU29|RSMC_SALSV Ribosomal RNA small subunit methyltransferase C OS=Salmonella schwarzengrund (strain CVM19633) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|B5FTB3|RSMC_SALDC Ribosomal RNA small subunit methyltransferase C OS=Salmonella dublin (strain CT_02021853) GN=rsmC PE=3 SV=1 29 136 1.0E-07
sp|Q1R2D5|RSMC_ECOUT Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 63 213 2.0E-07
sp|A1AJP2|RSMC_ECOK1 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O1:K1 / APEC GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|Q0T8U3|RSMC_ECOL5 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B7LEL6|RSMC_ECO55 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain 55989 / EAEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B7MTB6|RSMC_ECO81 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O81 (strain ED1a) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|Q2SZE1|PRMA_BURTA Ribosomal protein L11 methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=prmA PE=3 SV=1 52 132 2.0E-07
sp|A8ALZ1|RSMC_CITK8 Ribosomal RNA small subunit methyltransferase C OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rsmC PE=3 SV=1 56 154 2.0E-07
sp|B7MNC1|RSMC_ECO45 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B1XFI0|RSMC_ECODH Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12 / DH10B) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|P39406|RSMC_ECOLI Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12) GN=rsmC PE=1 SV=3 29 136 2.0E-07
sp|Q327M6|RSMC_SHIDS Ribosomal RNA small subunit methyltransferase C OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B7NH38|RSMC_ECOLU Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|Q8X510|RSMC_ECO57 Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O157:H7 GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B5Z4Q2|RSMC_ECO5E Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B4T4F9|RSMC_SALNS Ribosomal RNA small subunit methyltransferase C OS=Salmonella newport (strain SL254) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|B1IS49|RSMC_ECOLC Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rsmC PE=3 SV=1 29 136 2.0E-07
sp|A9MRB9|RSMC_SALAR Ribosomal RNA small subunit methyltransferase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmC PE=3 SV=1 29 136 3.0E-07
sp|B5Y286|RSMC_KLEP3 Ribosomal RNA small subunit methyltransferase C OS=Klebsiella pneumoniae (strain 342) GN=rsmC PE=3 SV=1 57 136 4.0E-07
sp|B7LNK6|RSMC_ESCF3 Ribosomal RNA small subunit methyltransferase C OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rsmC PE=3 SV=1 29 136 5.0E-07
sp|A4W687|RSMC_ENT38 Ribosomal RNA small subunit methyltransferase C OS=Enterobacter sp. (strain 638) GN=rsmC PE=3 SV=1 30 154 5.0E-07
sp|C6X2D2|TRMN6_FLAB3 tRNA1(Val) (adenine(37)-N6)-methyltransferase OS=Flavobacteriaceae bacterium (strain 3519-10) GN=FIC_02159 PE=3 SV=1 57 177 6.0E-07
sp|Q98G94|PRMC_RHILO Release factor glutamine methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=prmC PE=3 SV=1 32 135 6.0E-07
sp|Q1BZC1|PRMA_BURCA Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=prmA PE=3 SV=1 52 132 6.0E-07
sp|A0K4C9|PRMA_BURCH Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=prmA PE=3 SV=1 52 132 6.0E-07
sp|B4E5V2|PRMA_BURCJ Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prmA PE=3 SV=1 52 132 6.0E-07
sp|B1LEH4|RSMC_ECOSM Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rsmC PE=3 SV=1 29 136 6.0E-07
sp|A7MGA7|RSMC_CROS8 Ribosomal RNA small subunit methyltransferase C OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rsmC PE=3 SV=1 57 136 7.0E-07
sp|Q39JS9|PRMA_BURL3 Ribosomal protein L11 methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=prmA PE=3 SV=1 52 132 9.0E-07
sp|B1JVC0|PRMA_BURCC Ribosomal protein L11 methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=prmA PE=3 SV=1 52 132 1.0E-06
sp|Q8DPZ3|PRMC_STRR6 Release factor glutamine methyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prmC PE=3 SV=1 27 177 1.0E-06
sp|Q7VP87|RSMC_HAEDU Ribosomal RNA small subunit methyltransferase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rsmC PE=3 SV=1 67 182 1.0E-06
sp|A9AI41|PRMA_BURM1 Ribosomal protein L11 methyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=prmA PE=3 SV=1 52 132 1.0E-06
sp|Q0BIF9|PRMA_BURCM Ribosomal protein L11 methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=prmA PE=3 SV=1 52 132 2.0E-06
sp|B1YSW5|PRMA_BURA4 Ribosomal protein L11 methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=prmA PE=3 SV=1 52 132 2.0E-06
sp|Q6LUS5|RSMC_PHOPR Ribosomal RNA small subunit methyltransferase C OS=Photobacterium profundum GN=rsmC PE=3 SV=1 25 198 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5638
MASPRVDWEERISALITESKKHETTYSASIGGYTVHIHPTVYSPKYFPETLWYGENLPPIVRGRSFLEVGIGSGL
VSLCVAASGSTVTGVDINPHAVEVARKNFEENGQKGTFVVSDVFDNVNGKFDFIFWNHPWQIDSSVPKELKSEKT
FDQGYRLLKRFIAQAKDYLEPEGCVLLGTSAYADLEAMQAIYAANGFSHNVIQQGTRSIGKGITEEYYIIELRRN
Coding >Ophio5|5638
ATGGCTTCTCCGCGTGTTGATTGGGAAGAGCGCATCTCGGCGCTCATCACCGAGTCCAAGAAGCACGAGACGACA
TACTCGGCATCAATCGGTGGCTATACCGTTCACATCCATCCCACCGTCTACTCGCCCAAATACTTCCCCGAGACG
CTATGGTACGGTGAGAATCTGCCTCCGATCGTGAGGGGACGGTCCTTTCTCGAGGTCGGCATCGGCTCCGGCCTC
GTCTCGCTGTGCGTCGCCGCCTCAGGCTCGACGGTGACGGGCGTCGACATCAACCCGCATGCCGTCGAGGTGGCG
CGCAAGAACTTTGAGGAAAACGGCCAAAAGGGCACCTTTGTCGTCAGTGACGTCTTTGACAACGTCAACGGCAAG
TTTGACTTTATCTTCTGGAACCACCCGTGGCAGATCGACTCGTCGGTCCCCAAGGAACTCAAGTCGGAGAAGACG
TTCGATCAGGGCTATCGGCTGCTGAAGCGCTTCATCGCCCAGGCCAAGGATTACCTCGAGCCCGAAGGCTGCGTC
CTGCTTGGGACGAGTGCTTATGCCGACTTGGAGGCGATGCAGGCCATCTATGCCGCCAATGGCTTCTCCCACAAC
GTCATTCAGCAGGGGACGCGCTCTATTGGCAAGGGTATCACGGAGGAGTATTACATTATCGAATTGCGCCGCAAC
Transcript >Ophio5|5638
ATGGCTTCTCCGCGTGTTGATTGGGAAGAGCGCATCTCGGCGCTCATCACCGAGTCCAAGAAGCACGAGACGACA
TACTCGGCATCAATCGGTGGCTATACCGTTCACATCCATCCCACCGTCTACTCGCCCAAATACTTCCCCGAGACG
CTATGGTACGGTGAGAATCTGCCTCCGATCGTGAGGGGACGGTCCTTTCTCGAGGTCGGCATCGGCTCCGGCCTC
GTCTCGCTGTGCGTCGCCGCCTCAGGCTCGACGGTGACGGGCGTCGACATCAACCCGCATGCCGTCGAGGTGGCG
CGCAAGAACTTTGAGGAAAACGGCCAAAAGGGCACCTTTGTCGTCAGTGACGTCTTTGACAACGTCAACGGCAAG
TTTGACTTTATCTTCTGGAACCACCCGTGGCAGATCGACTCGTCGGTCCCCAAGGAACTCAAGTCGGAGAAGACG
TTCGATCAGGGCTATCGGCTGCTGAAGCGCTTCATCGCCCAGGCCAAGGATTACCTCGAGCCCGAAGGCTGCGTC
CTGCTTGGGACGAGTGCTTATGCCGACTTGGAGGCGATGCAGGCCATCTATGCCGCCAATGGCTTCTCCCACAAC
GTCATTCAGCAGGGGACGCGCTCTATTGGCAAGGGTATCACGGAGGAGTATTACATTATCGAATTGCGCCGCAAC
TAG
Gene >Ophio5|5638
ATGGCTTCTCCGCGTGTTGATTGGGAAGAGCGCATCTCGGCGCTCATCACCGAGTCCAAGAAGCACGAGACGACA
TACTCGGCATCAATCGGTGGCTATACCGTTCACATCCATCCCACCGTCTACTCGCCCAAATACTTCCCCGAGACG
CTATGGTACGGTGAGAATCTGCCTCCGATCGTGAGGGGACGGTCCTTTCTCGAGGTCGGCATCGGCTCCGGCCTC
GTCTCGCTGTGCGTCGCCGCCTCAGGCTCGACGGTGACGGGCGTCGACATCAACCCGCATGCCGTCGAGGTGGCG
CGCAAGAACTTTGAGGAAAACGGCCAAAAGGGCACCTTTGTCGTCAGTGACGTCTTTGACAACGTCAACGGCAAG
TTTGACTTTATCTTCTGGAACCACCCGTGGCAGATCGACTCGTCGGTCCCCAAGGAACTCAAGTCGGAGAAGACG
TTCGATCAGGGCTATCGGCTGCTGAAGCGCTTCATCGCCCAGGCCAAGGATTACCTCGAGCCCGAAGGCTGCGTC
CTGCTTGGGACGAGTGCTTATGCCGACTTGGAGGCGATGCAGGCCATCTATGCCGCCAATGGCTTCTCCCACAAC
GTCATTCAGCAGGGGACGCGCTCTATTGGCAAGGGTATCACGGAGGAGTATTACATTATCGAATTGCGCCGCAAC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail