Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5636
Gene name
Locationscaffold_467:7461..9228
Strand+
Gene length (bp)1767
Transcript length (bp)1767
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 5.6E-19 16 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDN3|LMBD1_NEUCR Probable lysosomal cobalamin transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02100 PE=3 SV=2 1 588 0.0E+00
sp|A6RN41|LMBD1_BOTFB Probable lysosomal cobalamin transporter OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_01863 PE=3 SV=1 5 576 0.0E+00
sp|B2AA26|LMBD1_PODAN Probable lysosomal cobalamin transporter OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_2600 PE=3 SV=1 1 576 0.0E+00
sp|A7F2V9|LMBD1_SCLS1 Probable lysosomal cobalamin transporter OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_12257 PE=3 SV=1 6 588 0.0E+00
sp|Q0UUE1|LMBD1_PHANO Probable lysosomal cobalamin transporter OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04623 PE=3 SV=1 6 576 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDN3|LMBD1_NEUCR Probable lysosomal cobalamin transporter OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02100 PE=3 SV=2 1 588 0.0E+00
sp|A6RN41|LMBD1_BOTFB Probable lysosomal cobalamin transporter OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_01863 PE=3 SV=1 5 576 0.0E+00
sp|B2AA26|LMBD1_PODAN Probable lysosomal cobalamin transporter OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_2600 PE=3 SV=1 1 576 0.0E+00
sp|A7F2V9|LMBD1_SCLS1 Probable lysosomal cobalamin transporter OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_12257 PE=3 SV=1 6 588 0.0E+00
sp|Q0UUE1|LMBD1_PHANO Probable lysosomal cobalamin transporter OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04623 PE=3 SV=1 6 576 0.0E+00
sp|B2WCU2|LMBD1_PYRTR Probable lysosomal cobalamin transporter OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07801 PE=3 SV=1 5 576 0.0E+00
sp|Q2TZ20|LMBD1_ASPOR Probable lysosomal cobalamin transporter OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090103000016 PE=3 SV=1 5 576 0.0E+00
sp|Q0D219|LMBD1_ASPTN Probable lysosomal cobalamin transporter OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_00015 PE=3 SV=1 5 576 0.0E+00
sp|A6QTW5|LMBD1_AJECN Probable lysosomal cobalamin transporter OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_00821 PE=3 SV=1 5 588 0.0E+00
sp|Q1E5A9|LMBD1_COCIM Probable lysosomal cobalamin transporter OS=Coccidioides immitis (strain RS) GN=CIMG_02254 PE=3 SV=1 5 576 0.0E+00
sp|A2R920|LMBD1_ASPNC Probable lysosomal cobalamin transporter OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An16g09150 PE=3 SV=1 5 583 0.0E+00
sp|Q2HDJ0|LMBD1_CHAGB Probable lysosomal cobalamin transporter OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_01714 PE=3 SV=1 1 554 0.0E+00
sp|A4RE85|LMBD1_MAGO7 Probable lysosomal cobalamin transporter OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00740 PE=3 SV=1 4 576 0.0E+00
sp|A1C3U0|LMBD1_ASPCL Probable lysosomal cobalamin transporter OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_057360 PE=3 SV=1 11 567 3.0E-176
sp|A1DB12|LMBD1_NEOFI Probable lysosomal cobalamin transporter OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_096740 PE=3 SV=1 10 564 5.0E-176
sp|Q5BDG8|LMBD1_EMENI Probable lysosomal cobalamin transporter OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1412 PE=3 SV=2 6 581 2.0E-175
sp|Q4WCL2|LMBD1_ASPFU Probable lysosomal cobalamin transporter OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_8G04030 PE=3 SV=1 10 525 2.0E-164
sp|B0YA61|LMBD1_ASPFC Probable lysosomal cobalamin transporter OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_083530 PE=3 SV=1 10 525 2.0E-164
sp|A7RM45|LMBD1_NEMVE Probable lysosomal cobalamin transporter OS=Nematostella vectensis GN=v1g160387 PE=3 SV=1 13 555 1.0E-75
sp|Q5PR61|LMBD1_DANRE Probable lysosomal cobalamin transporter OS=Danio rerio GN=lmbrd1 PE=2 SV=1 4 534 2.0E-69
sp|Q0VGV9|LMBD1_XENTR Probable lysosomal cobalamin transporter OS=Xenopus tropicalis GN=lmbrd1 PE=2 SV=1 20 529 3.0E-65
sp|Q5ZI05|LMBD1_CHICK Probable lysosomal cobalamin transporter OS=Gallus gallus GN=LMBRD1 PE=2 SV=1 13 529 9.0E-65
sp|Q3SYY9|LMBD1_BOVIN Probable lysosomal cobalamin transporter OS=Bos taurus GN=LMBRD1 PE=2 SV=1 18 534 6.0E-64
sp|Q7SYR6|LMBD1_XENLA Probable lysosomal cobalamin transporter OS=Xenopus laevis GN=lmbrd1 PE=2 SV=1 20 529 4.0E-63
sp|Q4R5E3|LMBD1_MACFA Probable lysosomal cobalamin transporter OS=Macaca fascicularis GN=LMBRD1 PE=2 SV=1 18 529 7.0E-63
sp|Q9NUN5|LMBD1_HUMAN Probable lysosomal cobalamin transporter OS=Homo sapiens GN=LMBRD1 PE=1 SV=1 1 529 2.0E-62
sp|Q8K0B2|LMBD1_MOUSE Probable lysosomal cobalamin transporter OS=Mus musculus GN=Lmbrd1 PE=1 SV=1 18 529 3.0E-60
sp|Q6AZ61|LMBD1_RAT Probable lysosomal cobalamin transporter OS=Rattus norvegicus GN=Lmbrd1 PE=1 SV=1 18 529 8.0E-59
sp|Q54KD1|LMBD1_DICDI Probable lysosomal cobalamin transporter OS=Dictyostelium discoideum GN=lmbrd1 PE=3 SV=1 13 556 5.0E-58
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 42 64 22
3 98 120 22
4 147 169 22
5 196 218 22
6 317 339 22
7 380 402 22
8 422 444 22
9 517 536 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5636
MADAGLVHTSLIWVAYAVAVGCCLLAAIITTFTWQTPRERSAVVSLVAIISLTALLATVLLLPVDIALVSATASP
SLGAKKDWATPDRVRSILQTLKIVYYSLYSLDALLCLIVIPFAYFWYEEYDEIEFEEEGRTWMSRLCAAAKYTLF
FVALVVALFLLGFFVPAAGDSHEAHWDLDYFKHLVAQSHGEKALTFALGLLMTLGTLLYVVYTGAGLALMPVSLI
KSAPAISAPQLSATTASQLEQNRARQRQLEMRNAGRSDGMSRKERRELEALVREEQTLVRRARLASEAQGEGRSR
VYQAWLRLCALLRPVKMLGGIALLVLSLLIWVSIFISGIDKAVNSVCKQRCGYILGHTHVFQPLNWILVKTARAF
PVDYVLMALLVLFLFSCSVSGIAAVGIRFLWIRVFQMRRGRTAPQALLTATVMMALAILAINYAVAMLVAPQYAT
YGTQTLCTNEPDGPGQQPACSSGSDRIRPCSEALHERHARDVCTPSVMSTFLNRINITWPVFGAIDFWAQFALLA
VFLVVFVTALFRAPNVNVSEMDEDAEADEEESLLATTGRRFGATWQDLRGRPAGGERGPSASG
Coding >Ophio5|5636
ATGGCCGACGCCGGCCTCGTACACACCAGCCTCATCTGGGTAGCCTATGCCGTCGCTGTCGGCTGCTGCCTCCTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGCTCCGCCGTCGTCAGCCTCGTGGCCATCATC
TCGCTGACGGCCCTGCTCGCCACCGTTCTCCTCCTCCCCGTCGATATCGCCCTCGTATCCGCCACGGCGTCGCCC
TCGCTCGGCGCCAAAAAGGACTGGGCCACGCCCGACCGCGTGCGAAGCATCCTGCAGACGCTGAAGATCGTCTAC
TACTCCCTCTACAGCCTCGACGCCCTGCTGTGCCTCATCGTCATCCCATTTGCCTACTTTTGGTACGAGGAATAT
GACGAGATCGAGTTTGAAGAAGAGGGCCGCACCTGGATGAGCCGGCTGTGTGCCGCCGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGCCTTGTTCCTGCTCGGCTTCTTCGTGCCCGCTGCCGGAGACTCGCACGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTGGCGCAGAGCCACGGCGAAAAGGCGCTGACGTTTGCCCTCGGTCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTCTACACCGGCGCTGGCCTCGCCCTCATGCCCGTCTCCCTCATC
AAGTCGGCGCCCGCCATCTCGGCGCCCCAGCTGTCGGCCACGACGGCCTCGCAGCTGGAACAGAACCGGGCGCGT
CAGCGTCAGCTCGAGATGCGCAACGCCGGCCGTTCGGACGGCATGTCGCGCAAGGAGAGGCGTGAACTCGAGGCC
CTCGTGCGTGAGGAGCAGACGCTGGTCCGGCGCGCACGTCTGGCCTCGGAGGCCCAGGGCGAGGGTCGCAGCCGC
GTCTACCAAGCCTGGCTCAGGCTCTGCGCCCTCTTGCGCCCCGTCAAAATGCTCGGCGGCATCGCGCTGCTGGTA
CTGTCCCTGCTCATCTGGGTGTCCATCTTCATCAGTGGCATCGACAAGGCCGTCAACTCGGTCTGCAAGCAGCGA
TGCGGCTACATTCTCGGCCACACGCACGTCTTCCAGCCGCTCAACTGGATCCTGGTCAAGACGGCGCGCGCGTTC
CCTGTCGACTACGTGCTGATGGCGCTGCTGGTGCTCTTCCTCTTCAGCTGCTCCGTTTCGGGCATCGCCGCCGTC
GGCATCCGCTTCCTCTGGATCCGCGTCTTCCAGATGAGGCGCGGCCGCACGGCGCCCCAGGCGCTGCTGACGGCC
ACGGTCATGATGGCGCTGGCCATCCTGGCCATCAACTATGCCGTCGCCATGCTTGTCGCGCCCCAGTACGCCACG
TACGGCACCCAGACGCTGTGCACCAACGAGCCAGACGGCCCCGGCCAGCAGCCCGCCTGCAGTTCCGGCTCGGAC
CGGATCCGCCCTTGCTCCGAGGCGCTGCACGAGCGGCACGCCCGCGACGTATGCACGCCGTCGGTCATGTCCACC
TTTCTGAACCGCATCAACATCACCTGGCCCGTCTTCGGCGCCATCGACTTTTGGGCGCAGTTCGCGCTGCTGGCC
GTCTTCCTCGTCGTCTTCGTCACCGCTCTGTTCCGCGCGCCGAACGTCAACGTTTCTGAGATGGACGAGGACGCC
GAGGCGGACGAGGAGGAGAGTCTGCTGGCAACGACGGGGCGACGATTCGGCGCGACGTGGCAGGACCTGCGAGGA
AGGCCTGCCGGCGGCGAGAGAGGCCCCTCGGCCTCGGGG
Transcript >Ophio5|5636
ATGGCCGACGCCGGCCTCGTACACACCAGCCTCATCTGGGTAGCCTATGCCGTCGCTGTCGGCTGCTGCCTCCTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGCTCCGCCGTCGTCAGCCTCGTGGCCATCATC
TCGCTGACGGCCCTGCTCGCCACCGTTCTCCTCCTCCCCGTCGATATCGCCCTCGTATCCGCCACGGCGTCGCCC
TCGCTCGGCGCCAAAAAGGACTGGGCCACGCCCGACCGCGTGCGAAGCATCCTGCAGACGCTGAAGATCGTCTAC
TACTCCCTCTACAGCCTCGACGCCCTGCTGTGCCTCATCGTCATCCCATTTGCCTACTTTTGGTACGAGGAATAT
GACGAGATCGAGTTTGAAGAAGAGGGCCGCACCTGGATGAGCCGGCTGTGTGCCGCCGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGCCTTGTTCCTGCTCGGCTTCTTCGTGCCCGCTGCCGGAGACTCGCACGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTGGCGCAGAGCCACGGCGAAAAGGCGCTGACGTTTGCCCTCGGTCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTCTACACCGGCGCTGGCCTCGCCCTCATGCCCGTCTCCCTCATC
AAGTCGGCGCCCGCCATCTCGGCGCCCCAGCTGTCGGCCACGACGGCCTCGCAGCTGGAACAGAACCGGGCGCGT
CAGCGTCAGCTCGAGATGCGCAACGCCGGCCGTTCGGACGGCATGTCGCGCAAGGAGAGGCGTGAACTCGAGGCC
CTCGTGCGTGAGGAGCAGACGCTGGTCCGGCGCGCACGTCTGGCCTCGGAGGCCCAGGGCGAGGGTCGCAGCCGC
GTCTACCAAGCCTGGCTCAGGCTCTGCGCCCTCTTGCGCCCCGTCAAAATGCTCGGCGGCATCGCGCTGCTGGTA
CTGTCCCTGCTCATCTGGGTGTCCATCTTCATCAGTGGCATCGACAAGGCCGTCAACTCGGTCTGCAAGCAGCGA
TGCGGCTACATTCTCGGCCACACGCACGTCTTCCAGCCGCTCAACTGGATCCTGGTCAAGACGGCGCGCGCGTTC
CCTGTCGACTACGTGCTGATGGCGCTGCTGGTGCTCTTCCTCTTCAGCTGCTCCGTTTCGGGCATCGCCGCCGTC
GGCATCCGCTTCCTCTGGATCCGCGTCTTCCAGATGAGGCGCGGCCGCACGGCGCCCCAGGCGCTGCTGACGGCC
ACGGTCATGATGGCGCTGGCCATCCTGGCCATCAACTATGCCGTCGCCATGCTTGTCGCGCCCCAGTACGCCACG
TACGGCACCCAGACGCTGTGCACCAACGAGCCAGACGGCCCCGGCCAGCAGCCCGCCTGCAGTTCCGGCTCGGAC
CGGATCCGCCCTTGCTCCGAGGCGCTGCACGAGCGGCACGCCCGCGACGTATGCACGCCGTCGGTCATGTCCACC
TTTCTGAACCGCATCAACATCACCTGGCCCGTCTTCGGCGCCATCGACTTTTGGGCGCAGTTCGCGCTGCTGGCC
GTCTTCCTCGTCGTCTTCGTCACCGCTCTGTTCCGCGCGCCGAACGTCAACGTTTCTGAGATGGACGAGGACGCC
GAGGCGGACGAGGAGGAGAGTCTGCTGGCAACGACGGGGCGACGATTCGGCGCGACGTGGCAGGACCTGCGAGGA
AGGCCTGCCGGCGGCGAGAGAGGCCCCTCGGCCTCGGGGTAG
Gene >Ophio5|5636
ATGGCCGACGCCGGCCTCGTACACACCAGCCTCATCTGGGTAGCCTATGCCGTCGCTGTCGGCTGCTGCCTCCTG
GCGGCCATCATCACCACCTTCACCTGGCAGACCCCCCGCGAGCGCTCCGCCGTCGTCAGCCTCGTGGCCATCATC
TCGCTGACGGCCCTGCTCGCCACCGTTCTCCTCCTCCCCGTCGATATCGCCCTCGTATCCGCCACGGCGTCGCCC
TCGCTCGGCGCCAAAAAGGACTGGGCCACGCCCGACCGCGTGCGAAGCATCCTGCAGACGCTGAAGATCGTCTAC
TACTCCCTCTACAGCCTCGACGCCCTGCTGTGCCTCATCGTCATCCCATTTGCCTACTTTTGGTACGAGGAATAT
GACGAGATCGAGTTTGAAGAAGAGGGCCGCACCTGGATGAGCCGGCTGTGTGCCGCCGCCAAGTACACCCTCTTC
TTCGTCGCCCTCGTCGTCGCCTTGTTCCTGCTCGGCTTCTTCGTGCCCGCTGCCGGAGACTCGCACGAGGCTCAC
TGGGACCTCGACTACTTCAAGCACCTGGTGGCGCAGAGCCACGGCGAAAAGGCGCTGACGTTTGCCCTCGGTCTG
CTCATGACGCTCGGCACCCTGCTGTACGTCGTCTACACCGGCGCTGGCCTCGCCCTCATGCCCGTCTCCCTCATC
AAGTCGGCGCCCGCCATCTCGGCGCCCCAGCTGTCGGCCACGACGGCCTCGCAGCTGGAACAGAACCGGGCGCGT
CAGCGTCAGCTCGAGATGCGCAACGCCGGCCGTTCGGACGGCATGTCGCGCAAGGAGAGGCGTGAACTCGAGGCC
CTCGTGCGTGAGGAGCAGACGCTGGTCCGGCGCGCACGTCTGGCCTCGGAGGCCCAGGGCGAGGGTCGCAGCCGC
GTCTACCAAGCCTGGCTCAGGCTCTGCGCCCTCTTGCGCCCCGTCAAAATGCTCGGCGGCATCGCGCTGCTGGTA
CTGTCCCTGCTCATCTGGGTGTCCATCTTCATCAGTGGCATCGACAAGGCCGTCAACTCGGTCTGCAAGCAGCGA
TGCGGCTACATTCTCGGCCACACGCACGTCTTCCAGCCGCTCAACTGGATCCTGGTCAAGACGGCGCGCGCGTTC
CCTGTCGACTACGTGCTGATGGCGCTGCTGGTGCTCTTCCTCTTCAGCTGCTCCGTTTCGGGCATCGCCGCCGTC
GGCATCCGCTTCCTCTGGATCCGCGTCTTCCAGATGAGGCGCGGCCGCACGGCGCCCCAGGCGCTGCTGACGGCC
ACGGTCATGATGGCGCTGGCCATCCTGGCCATCAACTATGCCGTCGCCATGCTTGTCGCGCCCCAGTACGCCACG
TACGGCACCCAGACGCTGTGCACCAACGAGCCAGACGGCCCCGGCCAGCAGCCCGCCTGCAGTTCCGGCTCGGAC
CGGATCCGCCCTTGCTCCGAGGCGCTGCACGAGCGGCACGCCCGCGACGTATGCACGCCGTCGGTCATGTCCACC
TTTCTGAACCGCATCAACATCACCTGGCCCGTCTTCGGCGCCATCGACTTTTGGGCGCAGTTCGCGCTGCTGGCC
GTCTTCCTCGTCGTCTTCGTCACCGCTCTGTTCCGCGCGCCGAACGTCAACGTTTCTGAGATGGACGAGGACGCC
GAGGCGGACGAGGAGGAGAGTCTGCTGGCAACGACGGGGCGACGATTCGGCGCGACGTGGCAGGACCTGCGAGGA
AGGCCTGCCGGCGGCGAGAGAGGCCCCTCGGCCTCGGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail