Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5626
Gene name
Locationscaffold_465:13821..15917
Strand-
Gene length (bp)2096
Transcript length (bp)1746
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 1.9E-25 93 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 2 580 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 4 491 3.0E-140
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 7 487 6.0E-121
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 16 497 4.0E-56
sp|O34987|PBUG_BACSU Guanine/hypoxanthine permease PbuG OS=Bacillus subtilis (strain 168) GN=pbuG PE=1 SV=1 19 476 5.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94300|YOOH_SCHPO Putative xanthine/uracil permease C887.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.17 PE=3 SV=1 2 580 0.0E+00
sp|Q9SRK7|AZG1_ARATH Adenine/guanine permease AZG1 OS=Arabidopsis thaliana GN=AZG1 PE=2 SV=1 4 491 3.0E-140
sp|Q84MA8|AZG2_ARATH Adenine/guanine permease AZG2 OS=Arabidopsis thaliana GN=AZG2 PE=2 SV=1 7 487 6.0E-121
sp|Q57772|Y326_METJA Putative permease MJ0326 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0326 PE=3 SV=1 16 497 4.0E-56
sp|O34987|PBUG_BACSU Guanine/hypoxanthine permease PbuG OS=Bacillus subtilis (strain 168) GN=pbuG PE=1 SV=1 19 476 5.0E-55
sp|O34978|PBUO_BACSU Guanine/hypoxanthine permease PbuO OS=Bacillus subtilis (strain 168) GN=pbuO PE=1 SV=1 29 476 2.0E-54
sp|P31440|ADEQ_ECOLI Adenine permease AdeQ OS=Escherichia coli (strain K12) GN=adeQ PE=1 SV=3 38 476 1.0E-52
sp|P31466|ADEP_ECOLI Adenine permease AdeP OS=Escherichia coli (strain K12) GN=adeP PE=1 SV=2 38 487 3.0E-48
sp|P0AF52|GHXP_ECOLI Guanine/hypoxanthine permease GhxP OS=Escherichia coli (strain K12) GN=ghxP PE=1 SV=1 19 477 2.0E-32
sp|P0AF53|GHXP_ECO57 Guanine/hypoxanthine permease GhxP OS=Escherichia coli O157:H7 GN=ghxP PE=3 SV=1 19 477 2.0E-32
sp|P44530|Y125_HAEIN Putative permease HI_0125 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0125 PE=3 SV=1 29 477 6.0E-30
sp|Q46817|GHXQ_ECOLI Guanine/hypoxanthine permease GhxQ OS=Escherichia coli (strain K12) GN=ghxQ PE=1 SV=2 39 477 9.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 102 124 22
3 144 166 22
4 186 208 22
5 238 257 19
6 324 346 22
7 366 388 22
8 401 423 22
9 428 450 22
10 471 493 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5626
MGWVHTVNGRVAASPVGRWFRLDGCGHPLARKDSFFLTEIRAGLATFFAMAYIIAVNSSIVADSGGSCVCRRTPE
DPNCDGDVGYMLCVQAVKRDAVTATAAISCLASVCMGLFANLPIGLAPGMGLNAYFAYTVVGYHGKGPVPYQVAL
TAIFVEGFIFLFLALIGMRQWLARAIPHSIKVATGVGIGLFLALIGLTYSEGIGLVLGATTTPTQLAGCSPSQLR
EGACPGAEKMRNPAMWLGIFGGGILTVLLAMYRVRGAVIVGIILVSLVSWPRDTLVTAFPRTELGDSAFDFFRHV
VSFHPIRRILHVQRWDVAEYGAQFGLALVTFLYVDILDCTGTLYGMARFAGLLDPVTHDFEGSSVAYVVDALSIS
VGAVFGLPPVTAFVESGAGISEGGKTGLTAVVTGLCFLVAVFFAPIFASIPPWATGCVLVLVGSMMAASVIEINW
KYMGDAVPAFLAVALMPFTYSIANGLIGSIGCYAVLNTVVWLLKVVSRGRIVPPNYADKEPWTWRIPGGVFPPWI
VRLARGDKRFWRRDAPSPNQDSLCRQRKLSSEPGADRSSSAETSSVRGSESRANDR
Coding >Ophio5|5626
ATGGGCTGGGTCCATACTGTCAACGGCCGGGTTGCGGCCAGTCCCGTGGGCCGTTGGTTCCGCCTCGACGGCTGC
GGCCATCCTCTCGCCCGCAAAGACTCCTTCTTTCTGACCGAGATCCGCGCCGGCCTGGCCACCTTCTTCGCCATG
GCCTACATCATCGCCGTCAACTCCTCCATCGTCGCCGACTCGGGCGGCTCCTGCGTGTGCCGCCGCACGCCCGAA
GACCCTAACTGCGACGGCGACGTGGGCTACATGTTGTGCGTGCAGGCTGTAAAGCGTGATGCAGTCACTGCCACT
GCGGCCATCTCTTGCCTGGCATCGGTGTGCATGGGCCTGTTTGCCAACTTACCCATTGGCCTTGCTCCCGGCATG
GGTCTCAACGCCTACTTCGCCTACACTGTCGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCAAGTCGCCCTC
ACGGCCATCTTCGTCGAAGGCTTCATCTTCCTCTTCCTCGCCCTCATCGGCATGCGGCAGTGGCTCGCTCGGGCC
ATCCCCCACTCCATCAAGGTGGCGACGGGCGTCGGCATCGGCCTCTTCCTAGCTCTCATCGGCCTGACCTACAGC
GAGGGCATCGGACTCGTCCTCGGCGCCACGACGACGCCTACCCAGCTCGCTGGCTGCTCACCCTCGCAGCTGCGG
GAGGGCGCGTGTCCTGGCGCGGAGAAGATGCGCAATCCGGCCATGTGGCTGGGCATCTTTGGAGGTGGCATCTTG
ACCGTGTTGCTGGCCATGTATCGTGTTCGTGGAGCCGTCATCGTCGGCATCATCCTCGTTAGCCTCGTCTCCTGG
CCGAGGGATACGCTTGTCACCGCCTTTCCGCGTACGGAGCTGGGCGACAGCGCATTCGACTTCTTCCGTCACGTC
GTCAGCTTTCATCCTATCCGCCGCATACTCCATGTTCAGCGCTGGGACGTAGCCGAGTACGGTGCTCAGTTCGGC
CTCGCCCTCGTCACCTTTCTCTACGTCGATATCCTCGACTGCACGGGCACGCTGTACGGCATGGCTCGCTTCGCT
GGCCTCCTCGATCCTGTGACGCACGACTTCGAGGGCTCGTCGGTTGCCTACGTCGTCGACGCGCTCAGCATCTCC
GTCGGCGCCGTCTTCGGCCTTCCCCCCGTCACGGCCTTTGTCGAGTCCGGCGCCGGCATCTCCGAGGGTGGAAAG
ACGGGCTTGACAGCCGTCGTGACGGGGCTATGCTTCCTCGTTGCCGTCTTCTTTGCCCCCATCTTCGCCTCTATC
CCGCCCTGGGCCACCGGCTGCGTCCTCGTCCTGGTCGGCTCCATGATGGCCGCCTCCGTCATCGAGATCAACTGG
AAGTACATGGGCGACGCTGTGCCCGCCTTTCTGGCCGTTGCCCTGATGCCTTTTACCTACTCCATCGCCAACGGT
CTCATCGGCAGCATCGGCTGCTATGCCGTTCTCAACACCGTCGTCTGGCTGCTCAAAGTCGTCTCGCGCGGCCGC
ATCGTGCCCCCCAACTACGCCGACAAGGAGCCCTGGACCTGGCGCATCCCCGGCGGCGTCTTCCCGCCCTGGATC
GTCCGCCTTGCCAGGGGCGACAAGCGCTTCTGGCGCCGAGACGCGCCGTCGCCTAACCAAGATTCTCTGTGCCGT
CAGCGAAAGCTCAGTTCCGAGCCGGGCGCCGACCGGAGCTCCTCTGCGGAGACAAGCTCGGTCAGGGGCTCGGAA
AGCAGGGCCAACGACCGT
Transcript >Ophio5|5626
ATGGGCTGGGTCCATACTGTCAACGGCCGGGTTGCGGCCAGTCCCGTGGGCCGTTGGTTCCGCCTCGACGGCTGC
GGCCATCCTCTCGCCCGCAAAGACTCCTTCTTTCTGACCGAGATCCGCGCCGGCCTGGCCACCTTCTTCGCCATG
GCCTACATCATCGCCGTCAACTCCTCCATCGTCGCCGACTCGGGCGGCTCCTGCGTGTGCCGCCGCACGCCCGAA
GACCCTAACTGCGACGGCGACGTGGGCTACATGTTGTGCGTGCAGGCTGTAAAGCGTGATGCAGTCACTGCCACT
GCGGCCATCTCTTGCCTGGCATCGGTGTGCATGGGCCTGTTTGCCAACTTACCCATTGGCCTTGCTCCCGGCATG
GGTCTCAACGCCTACTTCGCCTACACTGTCGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCAAGTCGCCCTC
ACGGCCATCTTCGTCGAAGGCTTCATCTTCCTCTTCCTCGCCCTCATCGGCATGCGGCAGTGGCTCGCTCGGGCC
ATCCCCCACTCCATCAAGGTGGCGACGGGCGTCGGCATCGGCCTCTTCCTAGCTCTCATCGGCCTGACCTACAGC
GAGGGCATCGGACTCGTCCTCGGCGCCACGACGACGCCTACCCAGCTCGCTGGCTGCTCACCCTCGCAGCTGCGG
GAGGGCGCGTGTCCTGGCGCGGAGAAGATGCGCAATCCGGCCATGTGGCTGGGCATCTTTGGAGGTGGCATCTTG
ACCGTGTTGCTGGCCATGTATCGTGTTCGTGGAGCCGTCATCGTCGGCATCATCCTCGTTAGCCTCGTCTCCTGG
CCGAGGGATACGCTTGTCACCGCCTTTCCGCGTACGGAGCTGGGCGACAGCGCATTCGACTTCTTCCGTCACGTC
GTCAGCTTTCATCCTATCCGCCGCATACTCCATGTTCAGCGCTGGGACGTAGCCGAGTACGGTGCTCAGTTCGGC
CTCGCCCTCGTCACCTTTCTCTACGTCGATATCCTCGACTGCACGGGCACGCTGTACGGCATGGCTCGCTTCGCT
GGCCTCCTCGATCCTGTGACGCACGACTTCGAGGGCTCGTCGGTTGCCTACGTCGTCGACGCGCTCAGCATCTCC
GTCGGCGCCGTCTTCGGCCTTCCCCCCGTCACGGCCTTTGTCGAGTCCGGCGCCGGCATCTCCGAGGGTGGAAAG
ACGGGCTTGACAGCCGTCGTGACGGGGCTATGCTTCCTCGTTGCCGTCTTCTTTGCCCCCATCTTCGCCTCTATC
CCGCCCTGGGCCACCGGCTGCGTCCTCGTCCTGGTCGGCTCCATGATGGCCGCCTCCGTCATCGAGATCAACTGG
AAGTACATGGGCGACGCTGTGCCCGCCTTTCTGGCCGTTGCCCTGATGCCTTTTACCTACTCCATCGCCAACGGT
CTCATCGGCAGCATCGGCTGCTATGCCGTTCTCAACACCGTCGTCTGGCTGCTCAAAGTCGTCTCGCGCGGCCGC
ATCGTGCCCCCCAACTACGCCGACAAGGAGCCCTGGACCTGGCGCATCCCCGGCGGCGTCTTCCCGCCCTGGATC
GTCCGCCTTGCCAGGGGCGACAAGCGCTTCTGGCGCCGAGACGCGCCGTCGCCTAACCAAGATTCTCTGTGCCGT
CAGCGAAAGCTCAGTTCCGAGCCGGGCGCCGACCGGAGCTCCTCTGCGGAGACAAGCTCGGTCAGGGGCTCGGAA
AGCAGGGCCAACGACCGTTAG
Gene >Ophio5|5626
ATGGGCTGGGTCCATACTGTCAACGGCCGGGTTGCGGCCAGTCCCGTGGGCCGTTGGTTCCGCCTCGACGGCTGC
GGCCATGTAAGATGATCCATTTCCTCTTGTCTGTGCGTCGGTGCCGTTGTGTCCTATACATGGACATCTATATCT
CGGACTTCTATACATGACAGATCTAAAACGACAAAGATGCCTATACATCATATAACCCCCATCACGCACACACCA
GAGACCGGCTAACCATGCACCAGCCTCTCGCCCGCAAAGACTCCTTCTTTCTGACCGAGATCCGCGCCGGCCTGG
CCACCTTCTTCGCCATGGCCTACATCATCGCCGTCAACTCCTCCATCGTCGCCGACTCGGGCGGCTCCTGCGTGT
GCCGCCGCACGCCCGAAGACCCTAACTGCGACGGCGACGTGGGCTACATGTTGTGCGTGCAGGCTGTAAAGCGTG
ATGCAGTCACTGCCACTGCGGCCATCTCTTGCCTGGCATCGGTGTGCATGGGCCTGTTTGCCAACTTGTCAGTCT
CTAGTGCTTCTTCGATTATGTCTCTTGACTAACACTGTCCTTGACTGAACAGACCCATTGGCCTTGCTCCCGGCA
TGGGTGAGTCCATCATTTGCGGTGAATAATTAGCATTGGACAAGAGGACTCATTTCTTACAAGGTCTCAACGCCT
ACTTCGCCTACACTGTCGGTGAGTAAAAAGGGAAAAAAAAAACATTTACCCCTGAGCCTCGCCCCAGCTAACCAC
CTCCAGTCGGCTACCACGGCAAAGGCCCCGTCCCCTATCAAGTCGCCCTCACGGCCATCTTCGTCGAAGGCTTCA
TCTTCCTCTTCCTCGCCCTCATCGGCATGCGGCAGTGGCTCGCTCGGGCCATCCCCCACTCCATCAAGGTGGCGA
CGGGCGTCGGCATCGGCCTCTTCCTAGCTCTCATCGGCCTGACCTACAGCGAGGGCATCGGACTCGTCCTCGGCG
CCACGACGACGCCTACCCAGCTCGCTGGCTGCTCACCCTCGCAGCTGCGGGAGGGCGCGTGTCCTGGCGCGGAGA
AGATGCGCAATCCGGCCATGTGGCTGGGCATCTTTGGAGGTGGCATCTTGACCGTGTTGCTGGCCATGTATCGTG
TTCGTGGAGCCGTCATCGTCGGCATCATCCTCGTTAGCCTCGTCTCCTGGCCGAGGGATACGCTTGTCACCGCCT
TTCCGCGTACGGAGCTGGGCGACAGCGCATTCGACTTCTTCCGTCACGTCGTCAGCTTTCATCCTATCCGCCGCA
TACTCCATGTTCAGCGCTGGGACGTAGCCGAGTACGGTGCTCAGTTCGGCCTCGCCCTCGTCACCTTTCTCTACG
TCGATATCCTCGACTGCACGGGCACGCTGTACGGCATGGCTCGCTTCGCTGGCCTCCTCGATCCTGTGACGCACG
ACTTCGAGGGCTCGTCGGTTGCCTACGTCGTCGACGCGCTCAGCATCTCCGTCGGCGCCGTCTTCGGCCTTCCCC
CCGTCACGGCCTTTGTCGAGTCCGGCGCCGGCATCTCCGAGGGTGGAAAGACGGGCTTGACAGCCGTCGTGACGG
GGCTATGCTTCCTCGTTGCCGTCTTCTTTGCCCCCATCTTCGCCTCTATCCCGCCCTGGGCCACCGGCTGCGTCC
TCGTCCTGGTCGGCTCCATGATGGCCGCCTCCGTCATCGAGATCAACTGGAAGTACATGGGCGACGCTGTGCCCG
CCTTTCTGGCCGTTGCCCTGATGCCTTTTACCTACTCCATCGCCAACGGTCTCATCGGCAGCATCGGCTGCTATG
CCGTTCTCAACACCGTCGTCTGGCTGCTCAAAGTCGTCTCGCGCGGCCGCATCGTGCCCCCCAACTACGCCGACA
AGGAGCCCTGGACCTGGCGCATCCCCGGCGGCGTCTTCCCGCCCTGGATCGTCCGCCTTGCCAGGGGCGACAAGC
GCTTCTGGCGCCGAGACGCGCCGTCGCCTAACCAAGATTCTCTGTGCCGTCAGCGAAAGCTCAGTTCCGAGCCGG
GCGCCGACCGGAGCTCCTCTGCGGAGACAAGCTCGGTCAGGGGCTCGGAAAGCAGGGCCAACGACCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail