Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5624
Gene name
Locationscaffold_465:10917..11725
Strand+
Gene length (bp)808
Transcript length (bp)579
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10785 NADH-u_ox-rdase NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit 8.1E-28 22 107
PF12853 NADH_u_ox_C C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit 9.7E-26 116 190

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02854|NUXM_NEUCR NADH-ubiquinone oxidoreductase 20.9 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo20.9 PE=1 SV=1 17 192 6.0E-94

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 45 62 17
2 77 95 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5624
MAETTTKQHPQTFVGASKVVQTDFPLIDNDPHFKRVIGYARTEDYVAGAVAAAFAPSALLILERFAPSHVGKGVF
PRAMRLAGFIGLAGGFLYFYQRSCLRFYGATENAREIEMDMREMVDKVKAGQPLYGESKLTPHMQGVAARQSRYS
ALFFSAIPWFNFVNHNQHGVDTAKYYQQAERELEMERTAKGS
Coding >Ophio5|5624
ATGGCCGAGACGACGACGAAGCAGCACCCACAAACGTTTGTGGGAGCGAGCAAAGTCGTCCAGACGGACTTTCCG
CTCATCGACAACGACCCCCACTTCAAACGCGTCATCGGATATGCCCGTACCGAGGACTATGTGGCCGGCGCCGTC
GCGGCTGCTTTTGCACCCTCGGCGCTGCTGATATTGGAGAGGTTTGCGCCTTCGCATGTCGGGAAGGGGGTGTTC
CCTAGGGCGATGCGTCTGGCGGGCTTTATTGGTCTCGCCGGTGGCTTCCTCTACTTTTACCAGCGCTCGTGTCTG
CGCTTCTACGGCGCGACGGAAAACGCGCGCGAAATCGAAATGGACATGCGCGAAATGGTGGACAAGGTCAAGGCC
GGCCAGCCGCTCTACGGCGAGAGCAAGCTGACGCCGCACATGCAAGGAGTGGCGGCGCGCCAGAGTCGATACTCG
GCACTCTTCTTCAGCGCCATCCCGTGGTTCAACTTTGTCAATCACAACCAGCACGGCGTCGACACAGCCAAGTAC
TACCAGCAGGCGGAGCGGGAGTTGGAGATGGAACGGACGGCCAAGGGCTCG
Transcript >Ophio5|5624
ATGGCCGAGACGACGACGAAGCAGCACCCACAAACGTTTGTGGGAGCGAGCAAAGTCGTCCAGACGGACTTTCCG
CTCATCGACAACGACCCCCACTTCAAACGCGTCATCGGATATGCCCGTACCGAGGACTATGTGGCCGGCGCCGTC
GCGGCTGCTTTTGCACCCTCGGCGCTGCTGATATTGGAGAGGTTTGCGCCTTCGCATGTCGGGAAGGGGGTGTTC
CCTAGGGCGATGCGTCTGGCGGGCTTTATTGGTCTCGCCGGTGGCTTCCTCTACTTTTACCAGCGCTCGTGTCTG
CGCTTCTACGGCGCGACGGAAAACGCGCGCGAAATCGAAATGGACATGCGCGAAATGGTGGACAAGGTCAAGGCC
GGCCAGCCGCTCTACGGCGAGAGCAAGCTGACGCCGCACATGCAAGGAGTGGCGGCGCGCCAGAGTCGATACTCG
GCACTCTTCTTCAGCGCCATCCCGTGGTTCAACTTTGTCAATCACAACCAGCACGGCGTCGACACAGCCAAGTAC
TACCAGCAGGCGGAGCGGGAGTTGGAGATGGAACGGACGGCCAAGGGCTCGTGA
Gene >Ophio5|5624
ATGGCCGAGACGACGACGAAGCAGCACCCACAAACGTTTGTGGGAGCGAGCAAAGTCGTCCAGACGGACTTTCCG
GTATGAAAGGTCGCGCGCCAGCAGGATGTGGTCAGTCTGGCGCGGCTAACCCGCATCGCAGCTCATCGACAACGA
CCCGTATGCCCCCCTTGTTGCGCGACCGAGATACAGACGCCGTCTCTCTACCTTAGTTTCAAGGTGAACTGACGC
TGTGGCAGCCACTTCAAACGCGTCATCGGATATGCCCGTACCGAGGACTATGTGGCCGGCGCCGTCGCGGCTGCT
TTTGCACCCTCGGCGCTGCTGATATTGGAGAGGTTTGCGCCTTCGCATGTCGGGAAGGGGGTGTTCCCTAGGGCG
ATGCGTCTGGCGGGCTTTATTGGTCTCGCCGGTGGCTTCCTCTACTTTTACCAGCGCTCGTGTCGTAAGTGCTTT
CAAATTCAAGAGAGAGACGTAAACTCGACAAGAACACCTTGTCTGAAGAACTGGGATCGCTGACGGCAGCTCGAA
AGTGCGCTTCTACGGCGCGACGGAAAACGCGCGCGAAATCGAAATGGACATGCGCGAAATGGTGGACAAGGTCAA
GGCCGGCCAGCCGCTCTACGGCGAGAGCAAGCTGACGCCGCACATGCAAGGAGTGGCGGCGCGCCAGAGTCGATA
CTCGGCACTCTTCTTCAGCGCCATCCCGTGGTTCAACTTTGTCAATCACAACCAGCACGGCGTCGACACAGCCAA
GTACTACCAGCAGGCGGAGCGGGAGTTGGAGATGGAACGGACGGCCAAGGGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail