Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5612
Gene name
Locationscaffold_463:14593..16601
Strand-
Gene length (bp)2008
Transcript length (bp)1707
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03055 RPE65 Retinal pigment epithelial membrane protein 1.9E-96 54 558

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9YGX2|RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus GN=RPE65 PE=1 SV=1 163 555 8.0E-32
sp|Q9JJS6|BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus GN=Bco1 PE=1 SV=2 22 558 2.0E-29
sp|Q91XT5|BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus GN=Bco1 PE=2 SV=1 160 558 2.0E-27
sp|Q91ZQ5|RPE65_MOUSE Retinoid isomerohydrolase OS=Mus musculus GN=Rpe65 PE=1 SV=4 163 555 6.0E-27
sp|Q9TVB8|RPE65_CANLF Retinoid isomerohydrolase OS=Canis lupus familiaris GN=RPE65 PE=1 SV=3 163 555 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9YGX2|RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus GN=RPE65 PE=1 SV=1 163 555 8.0E-32
sp|Q9JJS6|BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus GN=Bco1 PE=1 SV=2 22 558 2.0E-29
sp|Q91XT5|BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus GN=Bco1 PE=2 SV=1 160 558 2.0E-27
sp|Q91ZQ5|RPE65_MOUSE Retinoid isomerohydrolase OS=Mus musculus GN=Rpe65 PE=1 SV=4 163 555 6.0E-27
sp|Q9TVB8|RPE65_CANLF Retinoid isomerohydrolase OS=Canis lupus familiaris GN=RPE65 PE=1 SV=3 163 555 1.0E-26
sp|Q16518|RPE65_HUMAN Retinoid isomerohydrolase OS=Homo sapiens GN=RPE65 PE=1 SV=3 163 555 1.0E-26
sp|Q9HAY6|BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens GN=BCO1 PE=1 SV=1 160 555 2.0E-26
sp|Q9XT71|RPE65_CHLAE Retinoid isomerohydrolase OS=Chlorocebus aethiops GN=RPE65 PE=2 SV=3 163 555 4.0E-26
sp|O70276|RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus GN=Rpe65 PE=2 SV=4 163 558 6.0E-26
sp|Q99NF1|BCDO2_MOUSE Beta,beta-carotene 9',10'-oxygenase OS=Mus musculus GN=Bco2 PE=1 SV=1 56 558 4.0E-25
sp|Q28175|RPE65_BOVIN Retinoid isomerohydrolase OS=Bos taurus GN=RPE65 PE=1 SV=3 163 555 4.0E-25
sp|Q6PBW5|RP65A_DANRE Retinoid isomerohydrolase OS=Danio rerio GN=rpe65a PE=2 SV=1 64 558 8.0E-25
sp|Q8HXG8|BCDO2_MACFA Beta,beta-carotene 9',10'-oxygenase OS=Macaca fascicularis GN=BCO2 PE=2 SV=2 81 558 1.0E-24
sp|Q8AXN9|RPE65_CYNPY Retinoid isomerohydrolase OS=Cynops pyrrhogaster GN=RPE65 PE=2 SV=3 163 559 3.0E-24
sp|Q9YI25|RPE65_AMBTI Retinoid isomerohydrolase OS=Ambystoma tigrinum GN=RPE65 PE=2 SV=3 163 559 5.0E-24
sp|Q5RF16|BCDO2_PONAB Beta,beta-carotene 9',10'-oxygenase OS=Pongo abelii GN=BCO2 PE=2 SV=1 81 558 8.0E-24
sp|A9C3R9|RP65B_DANRE All-trans-retinyl ester 13-cis isomerohydrolase OS=Danio rerio GN=rpe65b PE=1 SV=1 160 558 2.0E-22
sp|A9C3R8|RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio GN=rpe65c PE=1 SV=1 160 558 8.0E-22
sp|Q9BYV7|BCDO2_HUMAN Beta,beta-carotene 9',10'-oxygenase OS=Homo sapiens GN=BCO2 PE=1 SV=5 81 558 1.0E-21
sp|Q9I993|BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus GN=BCO1 PE=1 SV=1 163 558 2.0E-21
sp|Q8VY26|CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana GN=CCD8 PE=1 SV=1 225 558 2.0E-19
sp|Q8LIY8|CCD8B_ORYSJ Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic OS=Oryza sativa subsp. japonica GN=CCD8B PE=1 SV=1 137 558 2.0E-19
sp|Q93VD5|CCD8A_ORYSJ Carotenoid cleavage dioxygenase 8 homolog A, chloroplastic OS=Oryza sativa subsp. japonica GN=CCD8A PE=2 SV=1 443 559 3.0E-17
sp|A8Y9I2|NINAB_GALME Carotenoid isomerooxygenase OS=Galleria mellonella GN=ninaB PE=1 SV=1 248 542 3.0E-17
sp|P74334|ACOX_SYNY3 Apocarotenoid-15,15'-oxygenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1541 PE=1 SV=1 251 554 1.0E-13
sp|P9WPR5|CCO_MYCTU Carotenoid cleavage oxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0654 PE=1 SV=1 201 558 2.0E-10
sp|P9WPR4|CCO_MYCTO Carotenoid cleavage oxygenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0683 PE=3 SV=1 201 558 2.0E-10
sp|Q9VFS2|NINAB_DROME Carotenoid isomerooxygenase OS=Drosophila melanogaster GN=ninaB PE=1 SV=1 453 558 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0051213 dioxygenase activity No
GO:0003674 molecular_function No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5612
METGRVMHRGAADENSDAEAMMARLEEGAWREWPNRAGFEGLVEHRGPIRLRVSVSVIYSSRRQSDEYVEHIRRV
GWRSSTSFGQRADPCVGIFAKLMSLFVPRRMNTNVICLPNLPGLPSVGSCATEKTSPPPISSSSTTTTTTTTTKA
DDARQRTGTKSIFISTDHAYLQEISPDTMEPLGYTSQHALHPDLAGPLSCAHAQRDPVTGDWFNYNLALGRVATY
RIFRVNAADGTTDVLATVSAPDLPAAYIHSFFLTENYVVLCIPGAHFAWNGLKILWERNIVDAIKPFDESRPCQW
LVVDRRHGRGLLCRFTTPAAFFFHSVNAFEDMVKDESDGVAAVDLCLDAVFYDNTDVIFALYYDVLLNRDNAMGK
FVDDGRYQKVRNRLTRYRFRMPTSTTTSTTTTTTTSTTTTTTTTDETNNNNNKQAELVFSIPNPHSGELSTINPG
RAGRPYRFVYGISTRGVSTFMDSIVKTDVETRDALLWTGPWGHTPGEPVFVPRPGASAEDDGVVLSVVLDGAAKK
SYLLCLDASTMHEMARAETDFAIAIGFHGFHAPALSGADGRVD
Coding >Ophio5|5612
ATGGAGACTGGCCGCGTAATGCACCGCGGCGCGGCGGACGAAAACTCAGACGCGGAAGCGATGATGGCCCGTTTG
GAAGAAGGCGCTTGGCGAGAGTGGCCGAACCGGGCCGGGTTCGAGGGACTGGTGGAGCATCGGGGACCGATCCGG
CTGCGGGTGTCCGTCTCCGTCATCTACTCATCCCGTCGCCAGTCGGATGAATACGTCGAGCATATCCGTCGGGTG
GGATGGCGGTCCAGCACCTCGTTCGGTCAGAGGGCCGACCCGTGCGTCGGCATCTTTGCCAAGCTCATGAGCCTC
TTCGTGCCCCGAAGAATGAACACCAATGTCATTTGTTTGCCCAACTTGCCCGGCCTTCCTAGTGTGGGGAGTTGT
GCGACGGAAAAGACGTCACCGCCCCCTATTTCTTCCTCTTCTACCACGACTACGACTACGACTACGACCAAGGCC
GACGACGCCCGTCAACGCACAGGGACCAAATCCATCTTCATCAGTACCGACCACGCCTACCTTCAGGAAATCAGT
CCGGACACGATGGAGCCTCTGGGTTACACCAGCCAACACGCCCTTCATCCGGACCTAGCAGGACCCCTATCGTGC
GCGCACGCGCAGAGGGATCCCGTGACGGGCGACTGGTTCAACTACAACCTAGCCCTGGGCCGGGTGGCCACCTAT
CGCATCTTCCGAGTCAACGCGGCAGACGGAACGACGGATGTTCTGGCTACCGTGTCGGCACCGGATCTACCCGCC
GCCTACATACACAGCTTCTTCCTGACGGAAAATTACGTCGTCTTGTGTATCCCCGGAGCGCACTTTGCCTGGAAC
GGGCTCAAGATTCTCTGGGAGAGGAACATCGTCGATGCCATTAAGCCCTTTGACGAATCGAGACCTTGTCAGTGG
CTCGTCGTTGATCGTCGTCACGGTAGGGGATTGCTTTGTCGCTTCACTACGCCCGCTGCGTTTTTCTTTCATTCT
GTCAACGCCTTTGAGGACATGGTCAAAGATGAGTCGGACGGGGTCGCCGCCGTCGACTTGTGTCTCGATGCCGTC
TTTTACGACAACACCGACGTCATCTTTGCCCTATACTACGATGTTCTTCTCAACCGGGACAACGCCATGGGCAAG
TTCGTCGACGACGGCCGCTATCAAAAGGTACGCAACCGTCTGACGCGGTACCGGTTCCGTATGCCGACGAGCACG
ACGACGAGCACGACGACGACGACGACGACGAGCACGACGACGACGACGACGACGACAGACGAGACGAACAACAAC
AACAACAAACAGGCCGAACTAGTCTTCTCCATCCCCAACCCGCACTCAGGCGAGCTATCGACCATCAATCCCGGA
CGCGCCGGCCGACCCTACCGCTTCGTCTACGGCATCAGCACCCGAGGCGTGAGCACCTTCATGGACTCCATCGTC
AAAACCGACGTCGAGACGCGCGACGCCCTACTCTGGACCGGACCCTGGGGTCACACCCCCGGCGAGCCCGTCTTC
GTACCCCGGCCCGGAGCGTCGGCCGAGGATGACGGCGTCGTCTTGTCTGTCGTCCTCGACGGCGCCGCTAAAAAG
TCCTATCTTTTGTGTCTTGATGCGAGTACCATGCACGAGATGGCCAGGGCCGAGACCGACTTTGCTATCGCTATT
GGCTTCCATGGCTTTCATGCCCCGGCTTTGTCGGGTGCGGATGGACGAGTGGAT
Transcript >Ophio5|5612
ATGGAGACTGGCCGCGTAATGCACCGCGGCGCGGCGGACGAAAACTCAGACGCGGAAGCGATGATGGCCCGTTTG
GAAGAAGGCGCTTGGCGAGAGTGGCCGAACCGGGCCGGGTTCGAGGGACTGGTGGAGCATCGGGGACCGATCCGG
CTGCGGGTGTCCGTCTCCGTCATCTACTCATCCCGTCGCCAGTCGGATGAATACGTCGAGCATATCCGTCGGGTG
GGATGGCGGTCCAGCACCTCGTTCGGTCAGAGGGCCGACCCGTGCGTCGGCATCTTTGCCAAGCTCATGAGCCTC
TTCGTGCCCCGAAGAATGAACACCAATGTCATTTGTTTGCCCAACTTGCCCGGCCTTCCTAGTGTGGGGAGTTGT
GCGACGGAAAAGACGTCACCGCCCCCTATTTCTTCCTCTTCTACCACGACTACGACTACGACTACGACCAAGGCC
GACGACGCCCGTCAACGCACAGGGACCAAATCCATCTTCATCAGTACCGACCACGCCTACCTTCAGGAAATCAGT
CCGGACACGATGGAGCCTCTGGGTTACACCAGCCAACACGCCCTTCATCCGGACCTAGCAGGACCCCTATCGTGC
GCGCACGCGCAGAGGGATCCCGTGACGGGCGACTGGTTCAACTACAACCTAGCCCTGGGCCGGGTGGCCACCTAT
CGCATCTTCCGAGTCAACGCGGCAGACGGAACGACGGATGTTCTGGCTACCGTGTCGGCACCGGATCTACCCGCC
GCCTACATACACAGCTTCTTCCTGACGGAAAATTACGTCGTCTTGTGTATCCCCGGAGCGCACTTTGCCTGGAAC
GGGCTCAAGATTCTCTGGGAGAGGAACATCGTCGATGCCATTAAGCCCTTTGACGAATCGAGACCTTGTCAGTGG
CTCGTCGTTGATCGTCGTCACGGTAGGGGATTGCTTTGTCGCTTCACTACGCCCGCTGCGTTTTTCTTTCATTCT
GTCAACGCCTTTGAGGACATGGTCAAAGATGAGTCGGACGGGGTCGCCGCCGTCGACTTGTGTCTCGATGCCGTC
TTTTACGACAACACCGACGTCATCTTTGCCCTATACTACGATGTTCTTCTCAACCGGGACAACGCCATGGGCAAG
TTCGTCGACGACGGCCGCTATCAAAAGGTACGCAACCGTCTGACGCGGTACCGGTTCCGTATGCCGACGAGCACG
ACGACGAGCACGACGACGACGACGACGACGAGCACGACGACGACGACGACGACGACAGACGAGACGAACAACAAC
AACAACAAACAGGCCGAACTAGTCTTCTCCATCCCCAACCCGCACTCAGGCGAGCTATCGACCATCAATCCCGGA
CGCGCCGGCCGACCCTACCGCTTCGTCTACGGCATCAGCACCCGAGGCGTGAGCACCTTCATGGACTCCATCGTC
AAAACCGACGTCGAGACGCGCGACGCCCTACTCTGGACCGGACCCTGGGGTCACACCCCCGGCGAGCCCGTCTTC
GTACCCCGGCCCGGAGCGTCGGCCGAGGATGACGGCGTCGTCTTGTCTGTCGTCCTCGACGGCGCCGCTAAAAAG
TCCTATCTTTTGTGTCTTGATGCGAGTACCATGCACGAGATGGCCAGGGCCGAGACCGACTTTGCTATCGCTATT
GGCTTCCATGGCTTTCATGCCCCGGCTTTGTCGGGTGCGGATGGACGAGTGGATTGA
Gene >Ophio5|5612
ATGGAGACTGGCCGCGTAATGCACCGCGGCGCGGCGGACGAAAACTCAGACGCGGAAGCGATGATGGCCCGTTTG
GAAGAAGGCGCTTGGCGAGAGTGGCCGAACCGGGCCGGGTTCGAGGGACTGGTGGAGCATCGGGGACCGATCCGG
CTGCGGGTGGTGGGTGAGATTCCTTGGTGGGCGGCGGGATCGTTGTATCGCACGGGACCGGGACAAAGTGCGATT
GAGAATACGGTCAACGGGACGCATTTCGTCTCGCATTGGTTTGATGGCTTTGCTCATTCTCATCGGTTTGATATC
GTTGTCGAAGGGGGGGGGAACGACGACGACGACGACGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNAGAAGAAGAAGAAGATGATGACAAGGACGACAAAGGGAAGAAAAAAAAGAC
CAGAAAACAGTCCGTCTCCGTCATCTACTCATCCCGTCGCCAGTCGGATGAATACGTCGAGCATATCCGTCGGGT
GGGATGGCGGTCCAGCACCTCGTTCGGTCAGAGGGCCGACCCGTGCGTCGGCATCTTTGCCAAGCTCATGAGCCT
CTTCGTGCCCCGAAGAATGAACACCAATGTCATTTGTTTGCCCAACTTGCCCGGCCTTCCTAGTGTGGGGAGTTG
TGCGACGGAAAAGACGTCACCGCCCCCTATTTCTTCCTCTTCTACCACGACTACGACTACGACTACGACCAAGGC
CGACGACGCCCGTCAACGCACAGGGACCAAATCCATCTTCATCAGTACCGACCACGCCTACCTTCAGGAAATCAG
TCCGGACACGATGGAGCCTCTGGGTTACACCAGCCAACACGCCCTTCATCCGGACCTAGCAGGACCCCTATCGTG
CGCGCACGCGCAGAGGGATCCCGTGACGGGCGACTGGTTCAACTACAACCTAGCCCTGGGCCGGGTGGCCACCTA
TCGCATCTTCCGAGTCAACGCGGCAGACGGAACGACGGATGTTCTGGCTACCGTGTCGGCACCGGATCTACCCGC
CGCCTACATACACAGCTTCTTCCTGACGGAAAATTACGTCGTCTTGTGTATCCCCGGAGCGCACTTTGCCTGGAA
CGGGCTCAAGATTCTCTGGGAGAGGAACATCGTCGATGCCATTAAGCCCTTTGACGAATCGAGACCTTGTCAGTG
GCTCGTCGTTGATCGTCGTCACGGTAGGGGATTGCTTTGTCGCTTCACTACGCCCGCTGCGTTTTTCTTTCATTC
TGTCAACGCCTTTGAGGACATGGTCAAAGATGAGTCGGACGGGGTCGCCGCCGTCGACTTGTGTCTCGATGCCGT
CTTTTACGACAACACCGACGTCATCTTTGCCCTATACTACGATGTTCTTCTCAACCGGGACAACGCCATGGGCAA
GTTCGTCGACGACGGCCGCTATCAAAAGGTACGCAACCGTCTGACGCGGTACCGGTTCCGTATGCCGACGAGCAC
GACGACGAGCACGACGACGACGACGACGACGAGCACGACGACGACGACGACGACGACAGACGAGACGAACAACAA
CAACAACAAACAGGCCGAACTAGTCTTCTCCATCCCCAACCCGCACTCAGGCGAGCTATCGACCATCAATCCCGG
ACGCGCCGGCCGACCCTACCGCTTCGTCTACGGCATCAGCACCCGAGGCGTGAGCACCTTCATGGACTCCATCGT
CAAAACCGACGTCGAGACGCGCGACGCCCTACTCTGGACCGGACCCTGGGGTCACACCCCCGGCGAGCCCGTCTT
CGTACCCCGGCCCGGAGCGTCGGCCGAGGATGACGGCGTCGTCTTGTCTGTCGTCCTCGACGGCGCCGCTAAAAA
GTCCTATCTTTTGTGTCTTGATGCGAGTACCATGCACGAGATGGCCAGGGCCGAGACCGACTTTGCTATCGCTAT
TGGCTTCCATGGCTTTCATGCCCCGGCTTTGTCGGGTGCGGATGGACGAGTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail