Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5609
Gene name
Locationscaffold_463:7492..9410
Strand+
Gene length (bp)1918
Transcript length (bp)1494
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.4E-25 67 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 50 491 6.0E-63
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 52 491 5.0E-27
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 59 229 6.0E-19
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 65 259 3.0E-14
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 55 291 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 50 491 6.0E-63
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 52 491 5.0E-27
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 59 229 6.0E-19
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 65 259 3.0E-14
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 55 291 4.0E-11
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 2 289 4.0E-11
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 60 248 1.0E-09
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 69 261 2.0E-09
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 2 260 2.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 2 260 2.0E-09
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 2 260 1.0E-08
sp|Q6BZA0|ALO_DEBHA D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALO1 PE=3 SV=2 55 233 1.0E-08
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 69 266 4.0E-08
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 58 237 6.0E-08
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 67 248 7.0E-08
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 74 224 1.0E-07
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 67 248 1.0E-07
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 4 267 1.0E-07
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 61 281 2.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 65 252 3.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 45 248 3.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 67 250 3.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 50 288 4.0E-07
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 67 278 6.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 61 242 6.0E-07
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 69 261 1.0E-06
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 67 244 3.0E-06
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 69 261 4.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 67 250 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.63 0.93 6.33
CcL In ants, during behavior modification 36.20 17.53 54.87
CcD In ants, recently dead 109.60 55.25 163.94

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5609
MLWFLNLLLFFGLALCALPRDHETYLAAAEKACRTALGLLGPKQVKTRPLNQTIVEQNWSLTCVTEPHCIVLPRD
AADVAVVMRVIKLNDVVFAVRAAGNSPNPGWSSIDKRGILIDLQRLNQVSVSGDAQRVRVGAGARWGEVMAAANN
HHVSVVGTRVSSLSVGGSILGGGYFFVPGYGLAADNVRSVEVVLADGHIVNASCTENKQLLWAIKGGGANFGIVT
KFELDTIPIDKIWYEVLALAKDQALDALDALAKWQLQEGSLDTKGNIVFSVSLDAVLLAFIYTEPQVSRPKCFAP
FYNLSPARTIVPATNGTFSSLYIIADSTLPKQVMRHDYRGASSLVDAQLYKDVYKFWEAKASTVFNNTGARQTFV
MQHVPAFMADYGVVRTGNPLGIPRRTHQWWTTLVDWTRAEDDSEARSVCIETADYWERLSKERRLGVPFLFMNDA
GRDQNPIATYGADNFKKLREVSLKYDSTQVFQRLQNDGFLLQKSVAL
Coding >Ophio5|5609
ATGTTGTGGTTTCTAAATCTCCTTCTCTTCTTCGGGCTGGCGCTGTGTGCCTTGCCAAGAGACCATGAAACCTAC
CTGGCGGCTGCTGAAAAAGCCTGTCGTACAGCGCTGGGACTCCTGGGACCGAAGCAAGTGAAGACACGGCCCCTG
AACCAGACGATTGTCGAGCAAAACTGGTCCTTGACATGTGTGACGGAACCGCACTGCATTGTTCTCCCCCGCGAC
GCAGCGGACGTTGCCGTAGTCATGCGAGTCATCAAGTTAAACGATGTCGTCTTCGCCGTCCGCGCCGCCGGCAAC
TCGCCCAACCCGGGCTGGTCAAGCATCGATAAACGAGGCATTCTGATAGACTTGCAGCGTCTGAATCAGGTTTCC
GTCTCTGGAGATGCTCAGCGCGTCCGTGTCGGTGCTGGCGCGCGATGGGGCGAGGTCATGGCCGCCGCCAACAAC
CATCACGTGTCTGTCGTCGGAACACGCGTCTCCAGCTTGAGTGTTGGAGGGAGCATCCTTGGAGGAGGATACTTT
TTCGTGCCCGGATACGGCCTGGCAGCAGACAATGTGAGAAGCGTCGAGGTCGTTCTTGCGGACGGGCACATTGTA
AACGCCAGCTGTACAGAAAACAAGCAGCTCCTTTGGGCCATCAAGGGAGGCGGTGCGAACTTTGGCATTGTCACG
AAATTCGAGCTCGACACCATTCCCATTGATAAGATATGGTATGAGGTCTTGGCCTTGGCCAAAGATCAGGCCCTC
GACGCCCTCGACGCCCTCGCCAAGTGGCAGCTCCAAGAAGGCTCCCTCGACACCAAGGGAAACATTGTCTTTTCC
GTCAGCCTAGACGCCGTACTGCTGGCCTTCATCTACACAGAGCCACAGGTATCGCGACCAAAGTGTTTCGCTCCA
TTCTACAACCTGTCGCCAGCCAGAACCATCGTCCCAGCCACCAACGGGACTTTCAGTTCTCTTTACATTATCGCC
GATTCGACGCTGCCGAAGCAAGTAATGCGCCATGATTACAGAGGTGCCAGCTCGCTGGTCGACGCGCAGCTCTAC
AAAGACGTATACAAGTTCTGGGAGGCGAAAGCCTCTACCGTCTTTAACAACACGGGAGCCCGTCAAACCTTTGTC
ATGCAACATGTTCCCGCCTTCATGGCCGATTACGGGGTCGTCAGGACGGGCAACCCATTGGGGATTCCACGTCGG
ACGCATCAATGGTGGACGACGCTCGTTGACTGGACCCGCGCAGAAGACGACAGCGAAGCTCGGTCTGTTTGCATC
GAAACGGCCGATTACTGGGAGCGACTTTCGAAAGAGCGTCGTCTGGGCGTCCCTTTCCTCTTCATGAACGATGCC
GGGCGAGATCAAAACCCGATTGCCACGTACGGAGCCGATAATTTTAAGAAGCTGCGAGAGGTTTCGTTAAAGTAT
GATTCAACCCAGGTTTTCCAGCGTTTGCAAAACGATGGTTTCTTGTTGCAGAAGTCAGTTGCTTTG
Transcript >Ophio5|5609
ATGTTGTGGTTTCTAAATCTCCTTCTCTTCTTCGGGCTGGCGCTGTGTGCCTTGCCAAGAGACCATGAAACCTAC
CTGGCGGCTGCTGAAAAAGCCTGTCGTACAGCGCTGGGACTCCTGGGACCGAAGCAAGTGAAGACACGGCCCCTG
AACCAGACGATTGTCGAGCAAAACTGGTCCTTGACATGTGTGACGGAACCGCACTGCATTGTTCTCCCCCGCGAC
GCAGCGGACGTTGCCGTAGTCATGCGAGTCATCAAGTTAAACGATGTCGTCTTCGCCGTCCGCGCCGCCGGCAAC
TCGCCCAACCCGGGCTGGTCAAGCATCGATAAACGAGGCATTCTGATAGACTTGCAGCGTCTGAATCAGGTTTCC
GTCTCTGGAGATGCTCAGCGCGTCCGTGTCGGTGCTGGCGCGCGATGGGGCGAGGTCATGGCCGCCGCCAACAAC
CATCACGTGTCTGTCGTCGGAACACGCGTCTCCAGCTTGAGTGTTGGAGGGAGCATCCTTGGAGGAGGATACTTT
TTCGTGCCCGGATACGGCCTGGCAGCAGACAATGTGAGAAGCGTCGAGGTCGTTCTTGCGGACGGGCACATTGTA
AACGCCAGCTGTACAGAAAACAAGCAGCTCCTTTGGGCCATCAAGGGAGGCGGTGCGAACTTTGGCATTGTCACG
AAATTCGAGCTCGACACCATTCCCATTGATAAGATATGGTATGAGGTCTTGGCCTTGGCCAAAGATCAGGCCCTC
GACGCCCTCGACGCCCTCGCCAAGTGGCAGCTCCAAGAAGGCTCCCTCGACACCAAGGGAAACATTGTCTTTTCC
GTCAGCCTAGACGCCGTACTGCTGGCCTTCATCTACACAGAGCCACAGGTATCGCGACCAAAGTGTTTCGCTCCA
TTCTACAACCTGTCGCCAGCCAGAACCATCGTCCCAGCCACCAACGGGACTTTCAGTTCTCTTTACATTATCGCC
GATTCGACGCTGCCGAAGCAAGTAATGCGCCATGATTACAGAGGTGCCAGCTCGCTGGTCGACGCGCAGCTCTAC
AAAGACGTATACAAGTTCTGGGAGGCGAAAGCCTCTACCGTCTTTAACAACACGGGAGCCCGTCAAACCTTTGTC
ATGCAACATGTTCCCGCCTTCATGGCCGATTACGGGGTCGTCAGGACGGGCAACCCATTGGGGATTCCACGTCGG
ACGCATCAATGGTGGACGACGCTCGTTGACTGGACCCGCGCAGAAGACGACAGCGAAGCTCGGTCTGTTTGCATC
GAAACGGCCGATTACTGGGAGCGACTTTCGAAAGAGCGTCGTCTGGGCGTCCCTTTCCTCTTCATGAACGATGCC
GGGCGAGATCAAAACCCGATTGCCACGTACGGAGCCGATAATTTTAAGAAGCTGCGAGAGGTTTCGTTAAAGTAT
GATTCAACCCAGGTTTTCCAGCGTTTGCAAAACGATGGTTTCTTGTTGCAGAAGTCAGTTGCTTTGTAG
Gene >Ophio5|5609
ATGTTGTGGTTTCTAAATCTCCTTCTCTTCTTCGGGCTGGCGCTGTGTGCCTTGTGAGTCTTCTATCCCCATTCT
TTTTCACACCGACTCGAATTTCTCACCAGTTGGCCAAGCAAACAAGGCCAAGAGACCATGAAACCTACCTGGCGG
CTGCTGAAAAAGCCTGTCGTACAGCGCTGGGACTCCTGGGACCGAAGCAAGTGAAGACACGGCCCCTGAACCAGA
CGATTGTCGAGCAAAACTGGCAAGCCAACCTTTCCCCAAAGCAGCCCTTGAAAGACGGCTGAGCAAACTCGGACA
GGTCCTTGACATGTGTGACGGAACCGCACTGCATTGTTCTCCCCCGCGACGCAGCGGACGTTGCCGTAGTCATGC
GAGTCATCAAGTTAAACGATGTCGTCTTCGCCGTCCGCGCCGCCGGCAACTCGCCCAACCCGGGCTGGTCAAGCA
TCGATAAACGAGGCATTCTGATAGACTTGCAGCGTCTGAATCAGGTTTCCGTCTCTGGAGATGCTCAGCGCGTCC
GTGTCGGTGCTGGCGCGCGATGGGGCGAGGTCATGGCCGCCGCCAACAACCATCACGTGTCTGTCGTCGGAACAC
GCGTCTCCAGCTTGAGTGTTGGAGGGAGCATCCTTGGAGGTACGCAGTTGCTTCCAAGACTCATCGAAAGCTCTG
CTTTGAGCGTCTTTGACGATGACGAAAGAGATGGAAACAAAGACTGATCGACTCGTTCTTGACTCGTACTAGGAG
GATACTTTTTCGTGCCCGGATACGGCCTGGCAGCAGACAATGTGAGAAGCGTCGAGGTAAGAGTGAAAAGAGCCC
TGACGTGTTCCCCTTTTCTATTTCCCATACTTGCTGACCCGATGGCAGGTCGTTCTTGCGGACGGGCACATTGTA
AACGCCAGCTGTACAGAAAACAAGCAGCTCCTTTGGGCCATCAAGGGAGGCGGTGCGAACTTTGGCATTGTCACG
AAATTCGAGCTCGACACCATTCCCATTGATAAGATATGGTATGAGGTCTTGGCCTTGGCCAAAGATCAGGCCCTC
GACGCCCTCGACGCCCTCGCCAAGTGGCAGCTCCAAGAAGGCTCCCTCGACACCAAGGGAAACATTGTCTTTTCC
GTCAGCCTAGACGCCGTACTGCTGGCCTTCATCTACACAGAGCCACAGGTATCGCGACCAAAGTGTTTCGCTCCA
TTCTACAACCTGTCGCCAGCCAGAACCATCGTCCCAGCCACCAACGGGACTTTCAGTTCTCTTTACATTATCGCC
GATTCGACGCTGCCGAAGCAAGTAATGCGGTAGGGGGGGTCACAATTCCAGCTTCCTTGTGCTACTGTGTATGTC
AACGTCTGACCAGTCTCTTCCAGCCATGATTACAGAGGTGCCAGCTCGCTGGTCGACGCGCAGCTCTACAAAGAC
GTATACAAGTTCTGGGAGGCGAAAGCCTCTACCGTCTTTAACAACACGGGAGCCCGTCAAACCTTTGTCATGCAA
CATGTTCCCGCCTTCATGGCCGATTACGGGGTCGTCAGGACGGGCAACCCATTGGGGATTCCACGTCGGACGCAT
CAATGTGAACCTCTCATCACCCTATCTCGCTGATACCTTGTCGATGCTGATTGTGACAGGGTGGACGACGCTCGT
TGACTGGACCCGCGCAGAAGACGACAGCGAAGCTCGGTCTGTTTGCATCGAAACGGCCGATTACTGGGAGCGACT
TTCGAAAGAGCGTCGTCTGGGCGTCCCTTTCCTCTTCATGAACGATGCCGGGCGAGATCAAAACCCGATTGCCAC
GTACGGAGCCGATAATTTTAAGAAGCTGCGAGAGGTTTCGTTAAAGTATGATTCAACCCAGGTTTTCCAGCGTTT
GCAAAACGATGGTTTCTTGTTGCAGAAGTCAGTTGCTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail