Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5606
Gene name
Locationscaffold_463:2463..4368
Strand+
Gene length (bp)1905
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.1E-19 79 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 41 536 2.0E-51
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 44 537 4.0E-23
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 61 195 1.0E-06
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 75 273 1.0E-05

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5606
MLTQIAFLASCLAAVTVVGSQDRAQAVSRGGGYESTARPWELACLNLGAILSAVTFFPWSRGYSAMSDQNWSGTA
RAKPACIVRPENATQLQTVVRLLRHKRVPFAVRSGGHNPAPGAASIDKGVLVDLGRLDDVVYAPGSRTVTVGAGN
KWTKVYTLLHEHELTVVGGRILDVGVGGLLLGSKSLSLSTRRSVLDVESAWPRLRQRRRTRGGLAPVLDDAFSPD
ENQGAGGASDSAALQVVLGNGTLVRANARDNADLHWALKGGGNNFGILASPLFLCGRRRLADRLYPLSQLPALYA
ALAEYQAAAKPDAHANVMLQAFPMNTTLGAVLTMVYLKPEVRPAVFAPFYRIPFTVDAIKIRTYLDLLANTHIPN
LPRYDWHASTFRPDGRLYASIQNMTSSPTNLDPLARLTSGTLAVGLQPMSRSGVLAGRSRGGGNALGLSSEAQTW
LVLGGAWYSAAGDSPGHEAIRALGDKIADAAGPELALPYLFMNDASYDQKVIASYGPQNVARLREVQRAYDPDRL
FQNLVPGGFKLG
Coding >Ophio5|5606
ATGTTGACGCAAATAGCCTTTCTGGCGTCCTGCCTCGCCGCCGTCACCGTCGTCGGCTCACAGGACAGGGCTCAG
GCCGTAAGCCGGGGCGGCGGCTATGAGTCGACTGCGCGTCCTTGGGAGCTCGCATGCCTCAATCTCGGCGCCATC
TTATCGGCCGTCACTTTCTTCCCCTGGAGCAGAGGCTACAGTGCGATGAGCGACCAGAACTGGTCGGGAACCGCC
AGGGCCAAGCCGGCATGCATTGTGCGGCCCGAGAACGCGACGCAGCTTCAGACGGTTGTTCGGCTTCTCAGACAT
AAGCGCGTGCCCTTTGCTGTCCGCTCAGGAGGCCATAATCCTGCCCCCGGGGCGGCCAGCATCGATAAGGGCGTG
CTGGTTGATCTTGGCCGCCTCGATGATGTGGTCTATGCCCCTGGCTCGAGAACGGTAACCGTCGGAGCGGGAAAC
AAGTGGACCAAGGTCTATACGCTTCTCCACGAGCATGAATTGACCGTCGTTGGCGGCAGGATTCTCGATGTCGGC
GTCGGCGGTCTGCTGCTGGGAAGCAAGTCTCTCTCTCTCTCGACCAGGCGGTCTGTCCTGGATGTCGAATCTGCA
TGGCCTCGGTTGCGACAACGTCGCCGAACACGAGGTGGGCTGGCTCCTGTTCTCGACGACGCATTTTCCCCAGAT
GAAAATCAGGGGGCAGGGGGAGCATCTGACTCGGCCGCGCTGCAGGTCGTTCTCGGAAACGGGACCTTGGTCAGA
GCAAACGCCAGAGATAACGCCGACCTCCACTGGGCTCTCAAAGGCGGCGGCAACAACTTTGGTATCTTGGCCAGT
CCTCTGTTCCTCTGTGGCAGACGACGCCTCGCTGACAGGCTGTATCCGCTGAGCCAGTTGCCGGCCTTGTATGCC
GCTCTGGCCGAGTATCAGGCTGCCGCCAAACCAGACGCCCATGCCAACGTCATGCTTCAGGCCTTTCCCATGAAC
ACCACCCTCGGTGCCGTTCTCACCATGGTCTACCTGAAGCCTGAGGTCCGGCCGGCCGTCTTCGCGCCCTTCTAT
CGAATTCCATTTACCGTCGACGCAATCAAGATCCGAACTTACCTGGACCTGCTGGCTAATACGCACATTCCCAAC
CTCCCCAGATACGACTGGCATGCCTCGACCTTTCGGCCGGACGGACGGTTGTACGCCTCGATCCAAAACATGACT
TCCTCGCCCACGAATCTCGACCCCCTGGCCCGGTTGACATCCGGCACCCTAGCCGTCGGCTTGCAACCAATGAGC
CGAAGCGGCGTCCTGGCCGGCCGATCTCGCGGCGGCGGAAACGCCCTGGGCTTATCCTCTGAAGCCCAGACATGG
CTGGTCCTCGGCGGCGCCTGGTATTCCGCCGCCGGTGACAGCCCGGGACACGAGGCCATTCGCGCCTTGGGCGAC
AAGATAGCGGACGCCGCTGGGCCGGAGCTCGCGCTGCCGTACTTGTTCATGAATGACGCCAGCTACGATCAGAAG
GTCATTGCGAGTTACGGGCCGCAGAACGTGGCCCGGCTGAGGGAGGTGCAGCGTGCGTACGATCCTGACCGTCTC
TTTCAGAACTTGGTTCCGGGTGGCTTCAAGCTGGGA
Transcript >Ophio5|5606
ATGTTGACGCAAATAGCCTTTCTGGCGTCCTGCCTCGCCGCCGTCACCGTCGTCGGCTCACAGGACAGGGCTCAG
GCCGTAAGCCGGGGCGGCGGCTATGAGTCGACTGCGCGTCCTTGGGAGCTCGCATGCCTCAATCTCGGCGCCATC
TTATCGGCCGTCACTTTCTTCCCCTGGAGCAGAGGCTACAGTGCGATGAGCGACCAGAACTGGTCGGGAACCGCC
AGGGCCAAGCCGGCATGCATTGTGCGGCCCGAGAACGCGACGCAGCTTCAGACGGTTGTTCGGCTTCTCAGACAT
AAGCGCGTGCCCTTTGCTGTCCGCTCAGGAGGCCATAATCCTGCCCCCGGGGCGGCCAGCATCGATAAGGGCGTG
CTGGTTGATCTTGGCCGCCTCGATGATGTGGTCTATGCCCCTGGCTCGAGAACGGTAACCGTCGGAGCGGGAAAC
AAGTGGACCAAGGTCTATACGCTTCTCCACGAGCATGAATTGACCGTCGTTGGCGGCAGGATTCTCGATGTCGGC
GTCGGCGGTCTGCTGCTGGGAAGCAAGTCTCTCTCTCTCTCGACCAGGCGGTCTGTCCTGGATGTCGAATCTGCA
TGGCCTCGGTTGCGACAACGTCGCCGAACACGAGGTGGGCTGGCTCCTGTTCTCGACGACGCATTTTCCCCAGAT
GAAAATCAGGGGGCAGGGGGAGCATCTGACTCGGCCGCGCTGCAGGTCGTTCTCGGAAACGGGACCTTGGTCAGA
GCAAACGCCAGAGATAACGCCGACCTCCACTGGGCTCTCAAAGGCGGCGGCAACAACTTTGGTATCTTGGCCAGT
CCTCTGTTCCTCTGTGGCAGACGACGCCTCGCTGACAGGCTGTATCCGCTGAGCCAGTTGCCGGCCTTGTATGCC
GCTCTGGCCGAGTATCAGGCTGCCGCCAAACCAGACGCCCATGCCAACGTCATGCTTCAGGCCTTTCCCATGAAC
ACCACCCTCGGTGCCGTTCTCACCATGGTCTACCTGAAGCCTGAGGTCCGGCCGGCCGTCTTCGCGCCCTTCTAT
CGAATTCCATTTACCGTCGACGCAATCAAGATCCGAACTTACCTGGACCTGCTGGCTAATACGCACATTCCCAAC
CTCCCCAGATACGACTGGCATGCCTCGACCTTTCGGCCGGACGGACGGTTGTACGCCTCGATCCAAAACATGACT
TCCTCGCCCACGAATCTCGACCCCCTGGCCCGGTTGACATCCGGCACCCTAGCCGTCGGCTTGCAACCAATGAGC
CGAAGCGGCGTCCTGGCCGGCCGATCTCGCGGCGGCGGAAACGCCCTGGGCTTATCCTCTGAAGCCCAGACATGG
CTGGTCCTCGGCGGCGCCTGGTATTCCGCCGCCGGTGACAGCCCGGGACACGAGGCCATTCGCGCCTTGGGCGAC
AAGATAGCGGACGCCGCTGGGCCGGAGCTCGCGCTGCCGTACTTGTTCATGAATGACGCCAGCTACGATCAGAAG
GTCATTGCGAGTTACGGGCCGCAGAACGTGGCCCGGCTGAGGGAGGTGCAGCGTGCGTACGATCCTGACCGTCTC
TTTCAGAACTTGGTTCCGGGTGGCTTCAAGCTGGGATGA
Gene >Ophio5|5606
ATGTTGACGCAAATAGCCTTTCTGGCGTCCTGCCTCGCCGCCGTCACCGTCGTCGGCTCACAGGACAGGGCTCAG
GCCGTAAGCCGGGGCGGCGGCTATGAGTCGACTGCGCGTCCTTGGGAGCTCGCATGCCTCAATCTCGGCGCCATC
TTATCGGCCGTCACTTTCTTCCCCTGGAGCAGAGGCTACAGTGCGATGAGCGACCAGAACTGGTCCGTTTTTCTT
TTTTTCCCTTCTCGCCAAGACGCACCCCTTGAGTAGACAGACTAACGATAACGCACAGGTCGGGAACCGCCAGGG
CCAAGCCGGCATGCATTGTGCGGCCCGAGAACGCGACGCAGCTTCAGACGGTTGTTCGGCTTCTCAGACATAAGC
GCGTGCCCTTTGCTGTCCGCTCAGGAGGCCATAATCCTGCCCCCGGGGCGGCCAGCATCGATAAGGGCGTGCTGG
TTGATCTTGGCCGCCTCGATGATGTGGTCTATGCCCCTGGCTCGAGAACGGTAACCGTCGGAGCGGGAAACAAGT
GGACCAAGGTCTATACGCTTCTCCACGAGCATGAATTGACCGTCGTTGGCGGCAGGATTCTCGATGTCGGCGTCG
GCGGTCTGCTGCTGGGAAGCAAGTCTTTCCCCCCCCCTCTGCACCATGTTTGTCTATTCTATCCAATATGCACGC
GCTGATAGGTCTCTCTCTCTCTCGACCAGGCGGTCTGTCCTGGATGTCGAATCTGCATGGCCTCGGTTGCGACAA
CGTCGCCGAACACGAGGTGGGCTGGCTCCTGTTCTCGACGACGCATTTTCCCCAGATGAAAATCAGGGGGCAGGG
GGAGCATCTGACTCGGCCGCGCTGCAGGTCGTTCTCGGAAACGGGACCTTGGTCAGAGCAAACGCCAGAGATAAC
GCCGACCTCCACTGGGCTCTCAAAGGCGGCGGCAACAACTTTGGTATCTTGGCCAGTCCTCTGTTCCTCTGTGGC
AGACGACGCCTCGCTGACAGGTGTTTTTTTTGGGGGGTTTTTTTTTCTGGCCAGGCATCGTCACCTCCTTCAAGC
TCTACACGTATCCCATGGACCGCGTATGGGGCGGTATCAGGCTGTATCCGCTGAGCCAGTTGCCGGCCTTGTATG
CCGCTCTGGCCGAGTATCAGGCTGCCGCCAAACCAGACGCCCATGCCAACGTCATGCTTCAGGCCTTTCCCATGA
ACACCACCCTCGGTGCCGTTCTCACCATGGTCTACCTGAAGCCTGAGGTCCGGCCGGCCGTCTTCGCGCCCTTCT
ATCGAATTCCATTTACCGTCGACGCAATCAAGATCCGAACTTACCTGGACCTGCTGGCTAATACGCACATTCCCA
ACCTCCCCAGGTGAGTCGAGCGCTGCTACACGACGGGGTGAATCCCCCCCCCCCCCTGACAAGGCAACCTCAAGA
TACGACTGGCATGCCTCGACCTTTCGGCCGGACGGACGGTTGTACGCCTCGATCCAAAACATGACTTCCTCGCCC
ACGAATCTCGACCCCCTGGCCCGGTTGACATCCGGCACCCTAGCCGTCGGCTTGCAACCAATGAGCCGAAGCGGC
GTCCTGGCCGGCCGATCTCGCGGCGGCGGAAACGCCCTGGGCTTATCCTCTGAAGCCCAGACATGGCTGGTCCTC
GGCGGCGCCTGGTATTCCGCCGCCGGTGACAGCCCGGGACACGAGGCCATTCGCGCCTTGGGCGACAAGATAGCG
GACGCCGCTGGGCCGGAGCTCGCGCTGCCGTACTTGTTCATGAATGACGCCAGCTACGATCAGAAGGTCATTGCG
AGTTACGGGCCGCAGAACGTGGCCCGGCTGAGGGAGGTGCAGCGTGCGTACGATCCTGACCGTCTCTTTCAGAAC
TTGGTTCCGGGTGGCTTCAAGCTGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail